CAZyme Information: P170DRAFT_461489-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_461489-t37_1-p1
• CAZy Family: GH76
• CAZyme Description: putative glucoamylase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484		51485.65	4.1326

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:5957575-5959154(-)

Full Sequence      

MWTKSLISLNILAGAVVAFPHAPIPKRQADIDAFLEKQTPIAKQGVLDNIGADGERVEGA
AAGIVVASPSKEDPDCLTMLAVVEQFLGGDDSLESLIQDYVDSQAKQQTVSNPSGDLSDG
TGLGEPKFHVDISAFTDSWGRPQRDGPPLRASALIAYGNSLIAKDQKSLAQDNIWPIVQN
DLSYVGQYWNESTFDLWEEVQGSSFFTTAVQHKALVEGKAFAEALGQACDSCSVAPQILC
HLQDFWDGSAVVSNIPTSGRSGLDANSLLTSIHTFDPTADCDDVTFQPCSSRALSNHKAV
VDSFRSIYNVNDGRGAGKAAAVGRYAEDTYQGGNPWYLTTLAAAEVLYDALYQWDKQGSL
TVTDTSLPFFQDLASNTTTGSYSKSSAEYTALTSAVKTYADGFVSVVQEYTPSDGGLAEQ
FTRDNGDPTSAVDLTWSFASFLTAASRRAGDVPASWGSSASELPSQCSGDTVTGSYATPT
PGSW

Enzyme Prediction     

EC	3.2.1.3:94

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	100	445	7.4e-62	0.817174515235457

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	2.20e-136	40	445	1	416	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
273702	oligosac_amyl	1.06e-09	157	442	338	607	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
225922	SGA1	2.29e-07	100	445	247	601	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39855.1|GH15	2.93e-270	1	484	1	493
QRD82209.1|GH15	2.93e-270	1	484	1	493
QMW27784.1|GH15	2.93e-270	1	484	1	493
UDD55716.1|GH15	2.93e-270	1	484	1	493
BAE57516.1|GH15|3.2.1.3	4.17e-270	1	484	1	493

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQA_A	4.01e-187	29	484	1	466	Catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol [Aspergillus niger]
6FRV_A	5.75e-185	29	484	1	466	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]
1AGM_A	1.07e-184	29	484	1	465	Refined structure for the complex of acarbose with glucoamylase from Aspergillus awamori var. x100 to 2.4 angstroms resolution [Aspergillus awamori],1DOG_A REFINED STRUCTURE FOR THE COMPLEX OF 1-DEOXYNOJIRIMYCIN WITH GLUCOAMYLASE FROM (ASPERGILLUS AWAMORI) VAR. X100 TO 2.4 ANGSTROMS RESOLUTION [Aspergillus awamori],1GLM_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori],3GLY_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori]
1GAH_A	1.11e-184	29	484	1	465	GLUCOAMYLASE-471 COMPLEXED WITH ACARBOSE [Aspergillus awamori]
1GAI_A	1.15e-184	29	484	1	465	GLUCOAMYLASE-471 COMPLEXED WITH D-GLUCO-DIHYDROACARBOSE [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14804|AMYG_NEUCR	4.79e-188	4	484	5	501	Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gla-1 PE=1 SV=3
sp|P69328|AMYG_ASPNG	2.83e-185	5	484	2	490	Glucoamylase OS=Aspergillus niger OX=5061 GN=GLAA PE=1 SV=1
sp|P69327|AMYG_ASPAW	2.83e-185	5	484	2	490	Glucoamylase OS=Aspergillus awamori OX=105351 GN=GLAA PE=1 SV=1
sp|P22832|AMYG_ASPUS	1.44e-182	5	484	2	489	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1
sp|P36914|AMYG_ASPOR	6.82e-182	23	484	22	492	Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=glaA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000421	0.999550	CS pos: 27-28. Pr: 0.6777

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_461489-t37_1-p1.