CAZyme Information: P170DRAFT_459736-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_459736-t37_1-p1
• CAZy Family: GH76
• CAZyme Description: pectate lyase plyA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MSFO01000011|CGC3	34149.61	4.9737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000011:688755-689951(+)

Full Sequence      

MVNFKQILAVAAALSGQALAAPTPTTNVKRASADDVAFGYASQNGGTTGGAGGTTTTVSS
YAAFSSAVQGNDAKIVYVDGNIKENAKQIKIGSNTSIIGKDANAILEGFGVIVKEESNVI
IRNLGVKKVLAENGDAIAVNKGTNVWIDHVDVSSDMDNGKDYYDGLIDLTHAADFITVSN
SFIHDHYKASLIGHSNSNEDEDKGHLRITYANNYWFNINSRAPSFRFGTGHIYNSYYENA
SDGINTRLGAQLLVESNQFVGSKKPLYSVDDDGYAVSNDNDFGDGENAAPKGTLTSVPYE
YSLVGSGKVKAAVVGTAGQTLTF

Enzyme Prediction     

EC	4.2.2.2:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	78	259	5.3e-88	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	8.28e-57	85	263	8	190	Amb_all domain.
226384	PelB	4.07e-46	70	318	73	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.57e-34	88	259	29	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40523.1|PL1_7|4.2.2.2	7.47e-169	1	323	1	323
BCS15716.1|PL1_7	4.31e-168	1	323	1	323
BCS04120.1|PL1_7	4.31e-168	1	323	1	323
CAX06687.1|PL1_7|4.2.2.2	8.68e-168	1	323	1	323
CAW62413.1|PL1_7|4.2.2.2	8.68e-168	1	323	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	1.96e-34	39	318	6	321	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	2.54e-30	34	270	5	285	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1OOC_A	6.29e-25	39	238	16	258	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]
1VBL_A	3.06e-24	89	238	128	302	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]
1JRG_A	4.29e-24	39	238	16	258	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QV36|PLYA_ASPNC	1.33e-169	1	323	1	323	Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=plyA PE=3 SV=1
sp|Q9C2Z0|PLYA_ASPNG	1.54e-168	1	323	1	323	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1
sp|Q2U8R6|PLYA_ASPOR	1.29e-157	1	323	1	321	Probable pectate lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyA PE=3 SV=1
sp|B8NE46|PLYA_ASPFN	1.29e-157	1	323	1	321	Probable pectate lyase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyA PE=3 SV=1
sp|Q4WIT0|PLYA_ASPFU	6.10e-156	10	323	8	321	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999731	CS pos: 30-31. Pr: 0.8483

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_459736-t37_1-p1.