CAZyme Information: P170DRAFT_450651-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_450651-t37_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MSFO01000009|CGC6	47688.36	8.6913

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000009:1379459-1380767(+)

Full Sequence      

MLPKGRRLVGRTVARRRFLFVALAVLSFVLWHNLPLLHKNGNRADRRTPKYDVDDVPHFV
HRASFRVDPDLEYEERVSQALRNIERAVIHENGGEYVARDRIWQVMLGKNRERSEDSLAF
EDENEGWEYSLVTTDTANAFIDSVFLTVPDLKDIYMAYPLDILRADLLRYLLLWYHGGYY
ADTDVFPKRSIKDCPSLEPLFTPPPHHKPNISLVIGIELDEPKASSQLMRHWRWTRRYGF
IQYTLYAPRRFSPLLRETIVRALSHTRQHIQQYLLPWGPRYNEHAILEISGPGMFTDTVL
DTLSQTLPPTNKLVEQSVGADLGVGDLMTHRSGLTQRRVTWAPFFGIKEPLCVDASEATD
AMGGLCVLPVNAWGNGQRHSGSENFGSQHACVNHRFKGSWKPWKKSWKEYFFG

Enzyme Prediction     

No EC number prediction in P170DRAFT_450651-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	124	194	9.9e-18	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	7.41e-12	124	191	15	83	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	8.30e-10	100	201	84	184	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW37982.1|GT32	1.40e-166	45	413	47	413
UCK58385.1|GT32	1.40e-166	45	413	47	413
QMW25899.1|GT32	2.82e-166	45	413	47	413
QRD88070.1|GT32	2.82e-166	45	413	47	413
BCS21634.1|GT32	5.51e-164	3	407	4	408

PDB Hits     

P170DRAFT_450651-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.53e-21	120	401	127	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.65e-18	102	350	134	347	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q9UTR6|OCH1_SCHPO	1.34e-17	102	401	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	5.08e-17	127	401	132	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000004

TMHMM  Annotations     

Start	End
13	35