CAZyme Information: P170DRAFT_449751-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_449751-t37_1-p1
• CAZy Family: GH5
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433	MSFO01000007|CGC4	48953.14	6.3398

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000007:2779833-2781286(-)

Full Sequence      

MQLSFFLSALFLWAEALPSTPRRHDTQKSIDLPELFSRATSSKIWNVAVDHLGKLPNKFP
DNIPGFTSNNGAYLFSDISAWTSGFFPGSLYALLERNTRFPSHLDLGNSSQVALHARLLA
LSRQWSDPLHEQAKRTDTHDMGFLIVPALRKDWELTGNTKSLESVITAAHSLATRYDPQV
RAIRSWDNLINKRHDIRDKTTDFLVIVDSMCNLDLLYYAGYQTANRTLVDIATTHAHTVI
RDIIREDHSTFHLVNIDPRNNSVKFQETVQGYKDWSTWSRGQAWSILGYAQTYQWTKDPV
FLDTAKGLADYFIGRLDESSHIHPYVPLWDFDAPVTAGKLPPRDTSAGLVAANGLLLLHQ
ILEGDSPYLERALRIVAETVDLSTAPPSWESIFMNATISNNEFSSDRSNNTGLVYADFYF
LEFGNRLLQMGLV

Enzyme Prediction     

No EC number prediction in P170DRAFT_449751-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	77	423	1.3e-92	0.9726443768996961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	5.63e-04	222	329	2	92	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	0.010	117	378	49	282	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT05078.1|GH88	6.90e-157	32	433	54	472
UKZ61432.1|GH88	2.26e-155	7	433	32	472
UKZ57213.1|GH88	3.41e-152	27	433	49	472
QKX60666.1|GH88	1.01e-144	17	433	46	476
UNI13371.1|GH88	6.74e-129	32	432	50	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	9.18e-41	81	422	73	383	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	2.18e-38	59	363	46	319	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	2.23e-38	59	363	47	320	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	1.14e-37	59	363	47	320	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	1.14e-37	59	363	47	320	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	3.27e-41	81	422	77	389	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q8E372|UCDH_STRA3	1.15e-37	59	363	47	320	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	5.51e-36	59	422	45	383	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	1.11e-35	59	422	48	386	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q9RC92|UGL_BACGL	1.34e-33	44	380	1	314	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999744	CS pos: 16-17. Pr: 0.9735

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_449751-t37_1-p1.