CAZyme Information: P170DRAFT_449685-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_449685-t37_1-p1
• CAZy Family: GH5
• CAZyme Description: galacturan 1,4-alpha-galacturonidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		45844.49	7.5799

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000007:2539772-2541323(+)

Full Sequence      

MHLSRLLFFLAALICVSAIRTSPRNTCVIPASGSNTTDDAPAIVQAFKQCGRGGKIIFKP
TTYHVNSVMNITWLEDVDIDIKGELLWGTNIQYWLNHSLPVGYQNQSTAFILGGNNVRID
GHGVGTLNGNGDTWYQWIQKQPNTSNYPGRPHGITFNGLTNSVVRGLSFLRSQMWTMSII
YSHHVLLDNILVNNTGNVVSSSNTDGADTIRSSHIKFNNWTVYNGDDSISLKGNSTDITI
TNSHFYNGLGIALGSIGQYKDQFETIERLNVKNVKFDNTLHAVYFKTWTAEQNGYPPNGG
GGGLGYASDMVLKDLTATSLRGSAVAISQCTRFIGAPGQGNCTSSEFQIRDITVANLSGT
TKSSRVASLQCSAVAPCTDIGLLDVDLKLTNGTAARQYLCGNVKDPKGFNCTGPVCEGGS
STGEC

Enzyme Prediction     

No EC number prediction in P170DRAFT_449685-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	61	405	2.4e-62	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215120	PLN02188	2.40e-28	1	404	1	391	polygalacturonase/glycoside hydrolase family protein
395231	Glyco_hydro_28	1.29e-25	113	387	49	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	1.86e-23	16	388	55	409	polygalacturonase ADPG
215426	PLN02793	4.56e-20	113	413	141	427	Probable polygalacturonase
178580	PLN03003	4.25e-17	123	416	119	388	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD90865.1|GH28	9.41e-264	1	425	1	421
UDD60769.1|GH28	2.21e-262	1	425	1	421
QMW31813.1|GH28	1.42e-254	1	425	1	414
BAE61240.1|GH28	2.34e-253	1	425	1	414
QMW43844.1|GH28	3.32e-253	1	425	1	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	7.35e-29	24	412	16	383	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1IA5_A	3.26e-14	102	411	58	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QG68|RGXB_ASPNC	2.38e-167	24	425	31	429	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2
sp|Q2UP32|RGXA_ASPOR	1.53e-69	38	402	41	427	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|B8NJB0|RGXA_ASPFN	1.53e-69	38	402	41	427	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|A2QBB4|RGXA_ASPNC	3.11e-69	14	411	17	436	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|Q2EQQ2|RGXA_ASPNG	6.14e-69	16	404	22	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999796	CS pos: 18-19. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_449685-t37_1-p1.