CAZyme Information: P170DRAFT_449643-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_449643-t37_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		27830.21	4.3075

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000007:2394800-2395729(+)

Full Sequence      

MGNPSLGQGTTADGINWVGYLTTEYNASVVMNYNLAAYGATVDDAVVDGKSKDLVYQVTS
DFNDYYCLSLEPSREWRPDTTLFGIWIGINDVLLSYMRDDPLEMISRILQSYLAVLDHLH
ECGARHFLLLNVPPTDRTPQMRWFEYWQRERHREVVVEFNRQLQAAVVGWRMTHRDSTMA
LYDSWSLMTEILDNPQIYGFEDGECMGQGCVWWDDLHPTSEFHRLLADDLATYLSQSGTG
FV

Enzyme Prediction     

No EC number prediction in P170DRAFT_449643-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	1	230	4.4e-72	0.898876404494382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.47e-47	2	231	26	268	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.63e-21	82	230	131	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	6.53e-13	85	230	84	224	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	2.30e-10	25	240	102	348	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	1.88e-07	32	228	62	275	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21167.1|CE16	8.86e-87	1	234	53	291
AFT91369.1|CE16	6.49e-84	1	234	57	298
EAA66810.1|CE16	6.79e-81	2	234	3	243
BCR91967.1|CE16	6.22e-64	1	238	84	341
QMW25447.1|CE16	9.69e-64	1	238	57	296

PDB Hits     

P170DRAFT_449643-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	1.55e-37	1	231	59	294	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	2.17e-37	1	231	59	294	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996484	0.003564

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_449643-t37_1-p1.