CAZyme Information: P170DRAFT_449188-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_449188-t37_1-p1
• CAZy Family: GH5
• CAZyme Description: putative endo-beta-1,4-glucanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		36686.69	4.0459

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000007:537840-539115(-)

Full Sequence      

MKLSSLIVAAAAGSAVAAPAAKEHKKRASAFEWIGTNEAGGEFGEDTIPGEWGTEFTFPE
IDAITTLIDKGMNIFRLQFMMERLTPDGMTGSYNEAYLKNFTTVVNAVTDAGVHAILDPH
NYGRFNGEIITEASDFQTFWENLAGEFKDNELVIFDTNNEYHDMDQDLVLDLNQAAIDGI
RAAGAKSQYIFVEGNSWSGAWTWRDVNDNLKALTDPQDKIVYQMHQYLDSDGSGTSETCV
STTIGSERVSDATAWLKENNKVGILGEFAGGVNDQCREALEGLLEHLADNTEVWKGAVWW
AAGPWWGDYMFNMEPPNGAAYTGMLDLLEPYLG

Enzyme Prediction     

EC	3.2.1.4:38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	33	310	3.8e-110	0.9964539007092199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.03e-74	37	303	2	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.24e-17	31	333	45	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88581.1|GH5_5	2.29e-198	1	333	1	333
BAE56461.1|GH5_5	2.29e-198	1	333	1	333
QMW25446.1|GH5_5	2.29e-198	1	333	1	333
QMW37515.1|GH5_5	2.29e-198	1	333	1	333
UCK57867.1|GH5_5	2.29e-198	1	333	1	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I77_A	4.13e-183	31	332	2	302	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	3.64e-182	31	332	4	304	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]
5I78_A	3.77e-182	31	332	5	305	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger],5I78_B Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
1GZJ_A	7.78e-156	31	332	3	304	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
6TPC_A	5.23e-154	22	331	4	313	Chain A, Endoglucanase [Talaromyces verruculosus],6TPC_C Chain C, Endoglucanase [Talaromyces verruculosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UPQ4|EGLB_ASPOR	4.08e-199	1	333	1	333	Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglB PE=3 SV=1
sp|B8MW97|EGLB_ASPFN	4.08e-199	1	333	1	333	probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglB PE=3 SV=1
sp|A1DME8|EGLB_NEOFI	4.35e-193	1	333	1	329	Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglB PE=3 SV=1
sp|Q96WQ8|EGLB_ASPKW	9.79e-193	4	332	5	332	Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglB PE=3 SV=1
sp|O74706|EGLB_ASPNG	2.46e-188	4	332	5	331	Endo-beta-1,4-glucanase B OS=Aspergillus niger OX=5061 GN=eglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000434	0.999537	CS pos: 27-28. Pr: 0.6141

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_449188-t37_1-p1.