CAZyme Information: P170DRAFT_448418-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_448418-t37_1-p1
• CAZy Family: GH5
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578	MSFO01000006|CGC27	62845.67	5.4394

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:724343-726131(+)

Full Sequence      

MPEFLSKKFDYIIVGGGTAGLLVAARLTENPNIHVGVLEAGDSKIDDPNVDRPEKFPNTL
NNPEYDWVFHSTPQTGNNNRVHHVPRGRMLGGSSGINFMAYIRPAAEDIDLWEKMGNTGW
SWEELRTYYLKSERFHGRNEAVGSGEIYRSTTSHGDSGPIITSLPSAKPPIEERFIAAFD
EVSGSLRAEDPYGGKPLGLYEHLSTVDPEHGTRSYAASAFLHPHRGRKNLQILPGATVCR
ILHDTNKDTFTATGVEFLYQGVIHRVSASIEIILAAGSIQTPQLLELSGIGDPRVLHATD
IDCTLAIPDVGNNLCEHPMTSLTYAIDGKASAHGGVSLIAFLPYGSLVPQGELDQAVGRI
DRVGSLSEVERQAVRSRLQDPASGAVQLNGISAYVDIESGHTDRGKLIPDVSGHEQIYYS
FLVTITSTLSRGSTHVVSSDPLVPPAIDLGLLNEEADVDLLAAGLEFADRVFSSRQVSDQ
VLKRVVPDPETDLRNRAQGREFVRDWATSFNHILGTCAMGKVVDERLQVKGMSGLRIVDA
SVIPTQISGNVLATVYAVAERAADMIKEDHQSFTLLGR

Enzyme Prediction     

No EC number prediction in P170DRAFT_448418-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	569	3.8e-156	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.74e-100	6	570	5	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.77e-91	6	567	3	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.09e-36	430	562	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.35e-30	65	318	1	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.36e-29	9	555	56	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ47931.1|AA3_2	2.95e-166	1	569	6	617
UBX54549.1|AA3_2	1.04e-163	1	571	6	612
UPX44764.1|AA3_2	3.91e-161	1	570	6	612
ALI92648.1|AA3_2	8.85e-160	3	569	8	611
AMU19396.1|AA3_2	8.85e-160	3	569	8	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.68e-75	6	572	3	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	4.39e-69	9	569	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.42e-68	9	569	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	3.24e-59	7	571	4	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5NIT_A	2.42e-57	7	572	16	579	Glucose oxidase mutant A2 [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.57e-160	3	569	8	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.57e-160	3	569	8	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	4.99e-156	1	570	6	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	1.02e-89	7	566	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.02e-89	7	566	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999961	0.000077

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_448418-t37_1-p1.