CAZyme Information: P170DRAFT_447942-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_447942-t37_1-p1
• CAZy Family: GH5
• CAZyme Description: glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	MSFO01000005|CGC8	65228.83	5.5882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000005:2013641-2015511(-)

Full Sequence      

MPIDPDFPSVADYVIVGGGTAGLTLAARLSENSTKSIVVLEAGRNLLEDPRVNIPALWTT
LMGSEADWQLQTVPQAALGDRVIKEPQGKLLGGSSGINGQAFIAPSQAGIDAWSKMGAKS
WTWEKLHPYYKKSYTVQLPDDATKAHIGIDWLDQSSNGTSGPLKVSFPAVIQDPLCRAWV
DTFKATGHGITADPFSGKSTGGYSNLAAVDSETKTRSYAASAYGRPAMERPNVHIITEAL
VQRILFNESEGPNVTASGIEALVQGQIRTVNANTEVIVCAGALNSPKLLELSGIGNEEIL
RQHNIPAVVHNPNVGENLQDHLMSGISFEVVDGVVTGDPLLRQKPEAVQAAMQLYTEHKA
GPMTIGGVQSSSFMPLVDFQNPHDSSAMKKYLDGFLSDPSNRDQAIREILEQPDAPTCSM
FMFLAQANLHEATGKSFVGQDLQPGNYLSMGVIQSLPFSRGRVHLASTDPSDKPTVDPRY
FSHPLDLDIMARNLQDVEKLHTVEPLAKFLKPGGRRNHPDAFLSDLDSAKKYLRDTATTT
YHSSGTAAMLPRENGGVVDETLRVYGTTNLRICDASIFPLIPAANIMSTVYAVAERAADI
IKMAA

Enzyme Prediction     

No EC number prediction in P170DRAFT_447942-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	602	1.4e-182	0.9894366197183099

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.39e-110	11	602	6	532	choline dehydrogenase; Validated
225186	BetA	1.68e-102	11	602	8	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.39e-40	457	597	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.70e-33	12	590	57	565	Protein HOTHEAD
366272	GMC_oxred_N	1.11e-29	86	322	22	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02826.1|AA3_2	4.04e-298	1	602	1	599
BCS14479.1|AA3_2	4.04e-298	1	602	1	599
CAK46356.1|AA3_2	9.44e-297	8	602	8	599
QDL52568.1|AA3_2	9.79e-297	8	602	9	600
QSS68114.1|AA3_2	1.05e-291	8	602	7	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	8.34e-87	12	602	7	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.60e-64	13	602	8	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3Q9T_A	2.98e-63	12	602	8	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.98e-63	12	602	8	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	5.75e-63	12	602	8	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	6.99e-110	3	601	6	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	2.32e-99	12	602	15	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.32e-99	12	602	15	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.76e-92	12	601	48	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.76e-92	12	601	48	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000033

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_447942-t37_1-p1.