CAZyme Information: P170DRAFT_447667-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_447667-t37_1-p1
• CAZy Family: GH47
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632		69807.74	6.0429

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000005:818286-820241(+)

Full Sequence      

MKVSLLGLALIASEALADSRTPKIIPGVTADPAKVANRTYDYIIAGGGLTGLTIANKILT
NTKATVLVIESGFYGSEYGPKIDDLNTYGQIFGSSVDHAYETSPQHEGRGNIIGLDKDVK
IVRAGNGLGGSTLINGGTWTRPQREQLDSWSQVFGNRDWTWDSLKPYMDGIEKPRNPAGI
WPKELYSYDPKCHNSGTTGNVEVGPRYGGEEKPWSKLIGALMNTVSATYPWVKNRKDLCC
GDPRGVSMFLNTLDAGQNRMDAARSWLDPVLADPNYSKRITVLTGQLVGKVHLNESDPNN
PSETHHATGVEFGVHQKELWKWDVNANKEVILAAGSAISPLILQWSGIGPEEWLADANIT
QKVDLPVGYNLQDQTTTTVIHNTIEEGKGQGQAAYFATFDEVFGAEAPLYKGLLDESGKL
EEWAMKTIEGGGFFKNQTVLLKQYENYRDWLRHKNTSYAELFFDTGELMHFDLWNLIPFT
RGYVKALDRDPYLRSFEYNPRFFENELDLAGQAAATRLARQLSQTHAMKPYAGIEKVPGK
RLVPEGADLKAWETYVMQSYRANYHGVGTCSMMSRELGGVVNQQAKVYDVGGLRVVDGSI
PPTQVSSHVMTVFYAMAAKIADDITGINSNMH

Enzyme Prediction     

EC	1.1.3.4:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	39	625	3.1e-127	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.91e-55	36	624	4	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.67e-45	36	626	2	533	choline dehydrogenase; Validated
366272	GMC_oxred_N	2.59e-32	121	376	20	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	4.61e-28	478	620	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	9.35e-25	41	606	2	468	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46116.1|AA3_2	8.03e-280	27	624	52	648
BCS05463.1|AA3_2	5.72e-278	27	624	54	650
BCS17017.1|AA3_2	5.72e-278	27	624	54	650
ANH22760.1|AA3_2	3.37e-237	27	624	47	640
BCR87417.1|AA3_2	3.10e-211	153	621	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NIW_A	1.96e-203	31	624	9	573	Glucose oxydase mutant A2 [Aspergillus niger]
5NIT_A	2.77e-203	31	624	9	573	Glucose oxidase mutant A2 [Aspergillus niger]
1CF3_A	5.96e-203	31	624	11	575	GLUCOSE OXIDASE FROM APERGILLUS NIGER [Aspergillus niger],1GAL_A CRYSTAL STRUCTURE OF GLUCOSE OXIDASE FROM ASPERGILLUS NIGER: REFINED AT 2.3 ANGSTROMS RESOLUTION [Aspergillus niger],3QVP_A Crystal structure of glucose oxidase for space group C2221 at 1.2 A resolution [Aspergillus niger],3QVR_A Crystal structure of glucose oxidase for space group P3121 at 1.3 A resolution. [Aspergillus niger]
1GPE_A	5.40e-197	30	624	15	579	Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense],1GPE_B Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense]
4YNT_A	6.48e-79	39	622	5	562	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P13006|GOX_ASPNG	3.24e-202	20	624	22	597	Glucose oxidase OS=Aspergillus niger OX=5061 GN=gox PE=1 SV=1
sp|P81156|GOX_PENAG	2.78e-196	30	624	15	579	Glucose oxidase OS=Penicillium amagasakiense OX=63559 PE=1 SV=1
sp|Q92452|GOX_TALFL	2.68e-193	3	624	6	597	Glucose oxidase OS=Talaromyces flavus OX=5095 GN=GOX PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	6.66e-56	8	626	14	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	6.66e-56	8	626	14	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000444	0.999530	CS pos: 17-18. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_447667-t37_1-p1.