CAZyme Information: P170DRAFT_444217-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_444217-t37_1-p1
• CAZy Family: GH43
• CAZyme Description: endoglucanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571		62253.02	4.8080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:2435968-2437983(+)

Full Sequence      

MQVLRAAAFAALFESTWAAVTCDGSFSDISASDYVAKLHPGWNLGNTLDAIPDEGSWNNA
PVQESTFDTVKSAGFKSVRLPVTWTHHFTGSSPDWTVDPEWLDRVSNVVDAITSRDFYTI
VNVHHDSWEWADVTQSGANITEIEEKFYRLWYQIGTKLACKSSRVAFESINEPPAETEAH
GTEINKLNEIFIKAIGDAGGFNKKRVVNLVGGGQDSVKTSQWFKAPANIPNPYAIQFHYY
APYDFIFSAWGKTIWGSDAEKDTLTTDFELIRNNFTNVPLILGEFDASSTNTEPAARWKY
HDQLAKAAAQFDIATILWDNGLDHLDRTKASWRDPTSIDILTKTTESTANGLPDSTEDAS
ATSQSSSAYIFHKSGTQVAAQTLPFILNGNTVESIKESGGSTLSKGSDYSVSGSNIVFSA
TYLAKHFSSSTSPGVIATLTVKFSGGVASPTIQLVQWDKPTLSSTSASASSVSGSDLSIP
VTWKGLSKLATVKALTASGKYLVDDWTQWLGPLQQARATYSNQWNWDDKNVILTSAAIDA
VVSAGETTTFTFEFYPRVNGTANAVEFKLNV

Enzyme Prediction     

EC	3.2.1.-:12	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	321	1.6e-68	0.9891304347826086
CBM46	366	447	2.9e-16	0.9080459770114943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.40e-34	54	321	16	269	Cellulase (glycosyl hydrolase family 5).
225344	BglC	9.43e-19	34	321	47	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
397483	CBM_X2	2.00e-18	369	453	6	82	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25048.1|GH5_4	1.95e-313	21	571	24	574
EAA59690.1|GH5_4	4.68e-309	2	571	3	572
CAP96338.1|GH5_4	1.36e-299	1	571	1	574
QQK43655.1|GH5_4	1.18e-295	22	571	44	592
QRD83200.1|GH5_4	1.43e-288	1	571	1	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YZP_A	1.01e-95	27	557	20	524	Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]
5E0C_A	9.02e-58	34	507	13	477	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
5XRC_A	2.26e-57	34	507	46	510	A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_B A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_C A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10]
5E09_A	1.73e-56	34	507	13	477	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
6XSU_A	8.10e-50	27	322	9	317	GH5-4 broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens],6XSU_B GH5-4 broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23550|GUNB_PAELA	4.02e-54	34	499	40	496	Endoglucanase B OS=Paenibacillus lautus OX=1401 GN=celB PE=3 SV=1
sp|P10477|CELE_ACET2	1.28e-43	28	341	54	381	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
sp|P28623|GUND_CLOC7	4.55e-42	28	321	40	339	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
sp|P28621|GUNB_CLOC7	6.10e-42	19	321	30	341	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
sp|P16218|GUNH_ACET2	1.55e-41	17	322	315	602	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000415	0.999542	CS pos: 18-19. Pr: 0.9702

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_444217-t37_1-p1.