CAZyme Information: P170DRAFT_443498-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_443498-t37_1-p1
• CAZy Family: GH43
• CAZyme Description: FAD binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	MSFO01000001|CGC36	56755.47	5.9980

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:6261153-6262820(+)

Full Sequence      

MRNFILPLVLLVASCDAGRNTPVVLNASNNIATSEACISLHSQYPALTLFPNETGFDSQT
HVESWSAAAWLTPACVFTPLKTEHVSVAVKTFAEMRVPFAIRGRGGMPISDAANSNSSGV
LISNSNFTTLRLSKDHSYISASPGNIWENVYKALEPYKLAAVGARLGVVGVSGFTLWGGV
SFFAYKHGLASSNVRAFECVLGDGTIVEATAWNQHSDLFWALKGGGNNFCFVTRFDFQTL
PAATIHVGSTSYNASSGDAFLDSVYNWAVNGSADTNSAVLPLVNLGNGAPSPSYSSTLFY
NGNDSSPVALRNFTEPAKSMSPLSNTFRRRTMYNYTLETDAPFKMDPSPALNYRQRFHTF
SFRVDREAMQYIHDVYIASVQPLLNISGFYTGLGYNIITPGLIRPGNEADGGNPQGIDEA
DYPAFWMESSLSWSEAADDGRIDAFVRSVGANLTTYLENRGLLTPFLYPNQADDTQAVFD
QYPARNVASLKDVRDKYDSAGVFTELVPGGFKLAHATSARGRS

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	65	370	9.5e-40	0.6550218340611353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	9.07e-18	73	210	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	3.45e-15	73	503	32	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
215242	PLN02441	4.38e-07	71	234	63	233	cytokinin dehydrogenase
185594	PTZ00395	0.001	251	414	388	537	Sec24-related protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADI58761.1|AA7|1.1.3.-	1.30e-12	73	270	37	236
ANF89368.1|AA7	1.39e-12	72	242	60	230
AEO58513.1|AA7|1.1.3.-	1.39e-12	72	242	60	230
AAS79317.1|AA7|1.1.3.-	1.85e-12	73	270	62	261
QRW06655.1|AA7	2.77e-12	7	279	9	279

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FYD_A	6.00e-16	49	257	23	226	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYE_A	7.98e-16	49	257	23	226	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6FYG_A	1.06e-15	49	257	23	226	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]
6FYF_A	1.06e-15	49	257	23	226	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYB_A	1.88e-15	49	257	23	226	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A023I4D6|PRX3_PENRO	4.61e-62	25	516	20	510	FAD-dependent monooxygenase prx3 OS=Penicillium roqueforti OX=5082 GN=prx3 PE=3 SV=1
sp|W6Q5R7|PRX3_PENRF	4.61e-62	25	516	20	510	FAD-dependent monooxygenase prx3 OS=Penicillium roqueforti (strain FM164) OX=1365484 GN=prx3 PE=3 SV=1
sp|B6H064|PRX3_PENRW	2.44e-61	34	516	29	510	FAD-dependent monooxygenase prx3 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=prx3 PE=2 SV=1
sp|D7UQ40|SOL5_ALTSO	5.65e-54	36	513	58	514	Bifunctional solanapyrone synthase OS=Alternaria solani OX=48100 GN=sol5 PE=1 SV=1
sp|A0A2P1DP98|MACF_PENTR	7.55e-47	63	506	82	508	FAD-dependent monooxygenase macF OS=Penicillium terrestre OX=374132 GN=macF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000282	0.999718	CS pos: 14-15. Pr: 0.8968

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_443498-t37_1-p1.