CAZyme Information: P170DRAFT_443472-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_443472-t37_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839	MSFO01000001|CGC7	93596.14	5.1278

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:6160202-6162967(+)

Full Sequence      

MTSDNFDKIIAQLSLAEKVSLLSGAGACRTNSLSRLDIPSLQTSDGPHGLRGGGGRFFNP
PPGYQLPCATALGATFDIDLLHRAGSLLGDEGRRKEVHVALAPTVCIQRSPLIGRGFEAF
AEDPVLSGTLAANLINGLQDRQVAACIKHYAAHDQSSRSTEDDVHMTQRTLREIHLLPFQ
IAMRSKPWSFMTAYQRINGLHVSEDPFLIEQILRKEWQFDGLVMSDWWGTYSTSEAINAG
LDLEMPGPSIWRGKQLIAAVECRKVSTQAVDSAVKNLLKLIRRTRDSWTQNAIETNENNG
DTPQSRELTRNLASASVVLLKNESNVLPLRPDASITYGLIGEHFENPATGGGGSSEATPF
YVSSPLDACVEVIGENFRYEPGCYSESLSQGGLFLPESEEPGLLLQWFAEDPSTYPMAEC
LHTTTTRNTSMYFSQMNIPAVPDTHFIRVQTRFHAFKTCKYRFALSVCGKARLLIDGQEV
VDLWTSHPLKTDDTPCFNKLSMERHFELDIVKGQKYDIQIVMTNEVIHPTVGPRSPGGVR
LGGQELRDEDQAINDAVRLAQEVDIPILMTGLSTDYEYEASDRTSLLLPGRENEMITRVC
EANSNTVVIIQAGMPIEMPWIQKVDTLVYAWYGGQETGHGIADVLWGKVNPAGRLSLTFP
RRLEDTPAFLNFGKVDRQIVYGEGVFVGYRYYEKLKCPPLFYFGYGLSYTQFRYSNLIVP
EKFPTTGDREIEISVDVENIGQCDGAEVVQAYVSDVECSLQRPRKELKVFQKMHIATGQK
LRCHVKLDKYAISFWSEEYSQWRAEAGEFEVIIATSADPKDEVLRGVCCLPETFMWSGL

Enzyme Prediction     

No EC number prediction in P170DRAFT_443472-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	246	1.8e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.28e-67	67	822	121	760	beta-glucosidase BglX.
224389	BglX	5.56e-56	61	368	78	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	7.37e-48	540	689	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.24e-39	66	280	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	9.40e-33	9	788	56	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP93483.1|GH3	0.0	1	839	1	840
QKD62631.1|GH3	5.87e-311	1	839	1	840
UPK95841.1|GH3	3.24e-310	7	839	10	839
CCT75598.1|GH3	1.14e-307	1	839	1	837
QPC71061.1|GH3	1.02e-306	9	839	12	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.02e-179	1	839	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.18e-174	7	839	7	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.36e-131	8	825	7	663	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.37e-99	3	817	2	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.00e-85	4	817	2	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R989|BGLI_ASPNC	1.57e-194	30	839	9	818	Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	2.31e-193	1	839	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	6.50e-193	1	839	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	9.18e-193	5	839	12	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q0CAF5|BGLI_ASPTN	2.66e-192	1	839	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_443472-t37_1-p1.