CAZyme Information: P170DRAFT_442680-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_442680-t37_1-p1
• CAZy Family: GH43
• CAZyme Description: putative extracellular exo-polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	MSFO01000001|CGC39	45160.22	4.4238

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:3014085-3015576(+)

Full Sequence      

MSLLFIFLLFILPVFAAPAVKVETVDGRKTCTVTSVGDEQNDVPNILSAFKECGSSGTVI
FPEGENYWIAERFTVDAEDVDIEWRGIWTFSDDIEYWRENSYPITFQNHAAGFILKGNGI
HINGHGTGGINGNGDLWYTDEAGTTKPGRPIPFQLWNISNVIVQNFAVLEPQLWAINIMN
GTNLEFENIHVNATATKAPSGKNWVQNTDGFDTMDTENVRLKNFTYTGGDDCIAIKPRSY
NIHIDGVVCNGGNGVAIGSLGQYLEDSSVESVFMQNVPRTRFGIYIKTWIGELVEQDGYE
SGDQPRGGGWGNVHNVTFSGVDVTNASRAVFITQNEGNNGSFAGTSKMEISNIAFDRFTG
TLASTSNKIGISCSKVYPCYDIAFSDTAVESSSGNNLTGKCTYVKADGVHGLSGC

Enzyme Prediction     

No EC number prediction in P170DRAFT_442680-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	52	405	4e-62	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	5.50e-33	117	406	50	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	8.75e-30	29	390	63	409	polygalacturonase ADPG
215426	PLN02793	5.96e-28	121	401	144	406	Probable polygalacturonase
178580	PLN03003	2.68e-26	126	406	119	377	Probable polygalacturonase At3g15720
215540	PLN03010	6.85e-23	37	407	56	392	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17534.1|GH28	1.66e-187	16	415	14	413
UQC90370.1|GH28	4.28e-182	2	415	10	429
CAK43283.1|GH28	4.58e-168	26	415	25	423
ABD61568.1|GH28	4.58e-168	26	415	25	423
BCR97806.1|GH28	2.63e-167	26	415	25	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	4.40e-34	23	396	11	367	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1IA5_A	8.66e-21	115	404	69	333	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
1HG8_A	2.46e-20	101	403	52	342	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
2IQ7_A	7.43e-20	115	404	65	331	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]
6KVE_A	2.38e-14	99	373	56	311	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAY7|RGXC_ASPNC	8.13e-169	26	415	25	423	Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxC PE=2 SV=1
sp|A1D415|RGXC_NEOFI	1.29e-150	22	415	23	423	Putative galacturan 1,4-alpha-galacturonidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rgxC PE=3 SV=1
sp|Q2UP32|RGXA_ASPOR	1.74e-72	16	412	20	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|B8NJB0|RGXA_ASPFN	1.74e-72	16	412	20	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|A2QBB4|RGXA_ASPNC	4.99e-72	16	409	18	434	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000227	0.999739	CS pos: 16-17. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_442680-t37_1-p1.