CAZyme Information: P170DRAFT_439566-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_439566-t37_1-p1
• CAZy Family: GH32
• CAZyme Description: mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		41023.47	5.1035

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000007:1634697-1635844(-)

Full Sequence      

MLTFRKAFVAAVLLITFIALLRSSHSSTSPAPSPIPVSAESDHDESSAAAERTPSQKKDQ
VQQQPLEPPPSAPLRDRLRYQFPYDLDGKFPAYIWQTWKYTPGSIWFTPELRDPEASWSE
LHPGFVHEVIPDDTQRHLIKHLYGSVPDVFEAYDSMPLPVLKADFFRYLILLARGGIYSD
IDTTALKPAHEWLPSKFDLSTVGFVVGIEADPDRPDWHDWYSRRIQFCQWTIQAKPGHPI
LRDIVAYITEEALRMKKAGILKTGKMDKTIVEFTGPAAWTDAIFRYFNNPDYFNIEPGFD
LNVTYEDFTYQEGYKKVGDVVVLPITSFSPGVQQMGAQDVDDPMAFVKHDFGGTWKSDPS
L

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	116	195	3.7e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.48e-43	74	358	66	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.79e-17	117	194	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBV36935.1|GT32	6.44e-214	1	361	1	359
BCS07268.1|GT32	1.13e-210	1	361	1	362
BCR94678.1|GT32	1.13e-210	1	361	1	362
CAK39413.1|GT32	1.61e-210	1	361	1	362
ACQ06321.1|GT32	2.13e-208	1	355	56	408

PDB Hits     

P170DRAFT_439566-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.34e-95	69	358	78	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	6.30e-82	75	358	129	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	6.02e-73	69	361	109	393	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.34e-70	74	358	80	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5UQW4|YL373_MIMIV	1.49e-07	91	290	3	171	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.654070	0.345942

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_439566-t37_1-p1.