CAZyme Information: P170DRAFT_438200-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_438200-t37_1-p1
• CAZy Family: GH31
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594	MSFO01000006|CGC8	65566.32	5.9537

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:278628-280513(-)

Full Sequence      

MSSVTNGSQYDFIIVGGGTAGNTIAGRLAENPNVRVLVIEAGIDNPHEVEDITTPSKAFG
LRGSKYDWAYKTTMIKREDYERVEKPNTRGKVLGGSSCANYFTWIPGSKATFDDWEEFGG
RDWTWDNCVEYLRKCATYHDDEKLYPSDLSKIGTGGPLQISHAELVPEMQPFRDALTQAW
VSSGEPLTEDIFAGEMHGLTHCVDTIYQGQRQGSFLYLLNKPNVTVLSSAQSKRLIIDPA
TRVCSGVEVINPATGAQTSVYATREVILSQGVFETPKLLMLSGVGPAEELSKHGIDVILN
SPHVGQHLLDHPIVPFVLRIKDGFGLDDHLLRAGPANDAAVAAYRRDKTGPVGSGLLELV
GFPRIDERLNQYPAYREAKAANQGLDPFGPGGQPHFELDFVGMFSSAFQWHYPVPKQGNY
MTVIVDLLRPVSEGGEVKLNSANPLVQPNINLNFFGSDLDVLAMREGVRWTYDVLTKGAG
FKDIVEQEYPWEMPLHSDEAMNKAVLERSQTGFHPCGTARLSKSVHQGVVDSKLRVHGIR
NLRVADASVIPVIPDCRIQNSVYMIGEKGADMIKAQHKDLYEMKNIAYFVPSRL

Enzyme Prediction     

No EC number prediction in P170DRAFT_438200-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	575	1.7e-152	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.74e-91	9	574	5	532	choline dehydrogenase; Validated
225186	BetA	2.07e-87	7	578	5	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	9.60e-41	430	568	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	7.05e-26	89	313	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.14e-21	2	566	48	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR87142.1|AA3_2	0.0	1	594	1	594
BCS00597.1|AA3_2	0.0	1	594	1	593
QMW45821.1|AA3_2	0.0	1	589	1	589
QMW33775.1|AA3_2	0.0	1	589	1	589
QRD94528.1|AA3_2	0.0	1	589	1	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	4.52e-315	5	581	2	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.29e-314	5	581	2	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	3.70e-314	5	581	2	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	5.64e-73	9	575	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.19e-72	8	575	1	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0T7N0|BETA_SHIF8	4.11e-61	9	592	2	548	Oxygen-dependent choline dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) OX=373384 GN=betA PE=3 SV=1
sp|B7N8L3|BETA_ECOLU	4.11e-61	9	592	2	548	Oxygen-dependent choline dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=betA PE=3 SV=1
sp|A9AMZ9|BETA_BURM1	5.04e-61	9	592	5	549	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|B1J0W6|BETA_ECOLC	5.72e-61	9	592	2	548	Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) OX=481805 GN=betA PE=3 SV=1
sp|B1XE52|BETA_ECODH	5.72e-61	9	592	2	548	Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain K12 / DH10B) OX=316385 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999951	0.000104

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_438200-t37_1-p1.