CAZyme Information: P170DRAFT_437955-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_437955-t37_1-p1
• CAZy Family: GH31
• CAZyme Description: putative beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MSFO01000005|CGC14	54461.98	4.8712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000005:2474696-2476408(+)

Full Sequence      

MGSTSASSLPSDFLWGFATASYQIEGAVEEDGRGPSIWDTFCKIPGKIAGSATGDVACDS
YHRTHEDIALLKECGAKAYRFSISWSRIIPLGGRNDPVNEKGIQHYVKFIDDLHAAGIVP
LVTLYHWDLPDELDKRYGGLLNKEEFVADFANYARVIFKAFGSKVKHWITFNEPWCSSVL
GYNVGQFAPGRTSDRARNPVGDGSTEPWIVGHSLLVAHGKAVQIYRDEFKAQDGGEIGIT
LNGDWAEPWDPENPADVEACDRKIEFAISWFADPIYHGKYPDSMVKQLGDRLPKWTPEDI
ALVHGSNDFYGMNHYCANYIKAKTGEADPNDTAGNLEILLQNKNGEWVGPETQSPWLRPS
AIGFRKLLKWLSDRYNQPKILVTENGTSLKNENDLPLDQLLKDEFRTQYFRDYIAAMADA
YTLDGVNVRGYMAWSLMDNFEWAEGYETRFGVTYVDYENNQKRIPKESARAIGPIFEQYI
QKE

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	476	2.3e-163	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274539	BGL	0.0	10	470	1	424	beta-galactosidase.
395176	Glyco_hydro_1	0.0	8	470	4	442	Glycosyl hydrolase family 1.
225343	BglB	1.44e-145	7	470	2	444	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	5.67e-112	5	469	26	473	beta-glucosidase
215435	PLN02814	4.12e-107	7	469	26	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD82378.1|GH1	0.0	1	482	1	482
QMW27934.1|GH1	0.0	1	482	1	482
UDD55888.1|GH1	0.0	1	482	1	482
QMW40005.1|GH1	0.0	1	482	1	482
CAK47813.1|GH1	0.0	1	483	1	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	4.93e-278	8	483	25	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	5.34e-246	9	483	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	5.89e-243	9	483	3	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	1.18e-242	9	483	22	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	3.94e-238	9	480	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	2.91e-198	9	480	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	1.14e-183	5	482	2	462	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	1.63e-146	5	482	18	517	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q339X2|BGL34_ORYSJ	1.14e-144	2	470	31	500	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q8L7J2|BGL06_ORYSJ	8.43e-142	2	470	43	513	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000001

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_437955-t37_1-p1.