CAZyme Information: P170DRAFT_436503-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_436503-t37_1-p1
• CAZy Family: GH3
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	MSFO01000004|CGC7	56378.75	5.2577

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000004:598099-599691(-)

Full Sequence      

MEEADYVIVGGGTAALVVACRLSEKPDTRIVVLERGEDVSSDARVQDSLAYESLVGSEMD
WNLKVAPQAGLNGREFNQPAGKALGGSSMINGCVFLPPAAAVLNAWDSLGNPGWNWDTLA
PYFQRAYTLHPRTGVPNPAGPIQVSYPVSTQREDTTLLDAWKQAFEEHGYTYADELVSDG
ATIGTRPYTATVDPVSGHRSSAASAYGAILASRANVRIVTGATVTRIRFDSSAPNDNPTA
TGVEVQTEAGGTILFKPTQEVIMAAGVFNTPKILELSGIGDQTRLQQLGIPPLIHLPGVG
ENLTNHAMSILTAPVKAHADMQGLTPGMKANALIRLAPADMHDILDQARESPDHPAIAGI
LNDSNQASACVHFAIYPGNLAVIGLFPSFPFSRGSVHIQSADPASSSQIDPKYLTNPSDH
DSMIRHVQHLQEILRSTQLLPFVDAPPPHDREVLAQLVREAMAVPVAHPCGTTAMLPREK
GGVVGPDLKVYGVSNVRVVDASIFPLIPQANPISTVYTVAERAADLIRAS

Enzyme Prediction     

No EC number prediction in P170DRAFT_436503-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	529	2.9e-143	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.59e-93	1	529	5	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.55e-86	1	528	3	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.32e-33	390	523	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.79e-28	72	306	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.20e-23	5	516	57	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW44362.1|AA3_2	0.0	1	530	1	532
UDD57301.1|AA3_2	0.0	1	530	1	532
QRD83786.1|AA3_2	0.0	1	530	1	532
QMW32332.1|AA3_2	0.0	1	530	1	532
BCS25452.1|AA3_2	1.21e-153	3	528	8	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	8.32e-69	5	528	7	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	6.27e-54	3	529	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.65e-53	3	529	2	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	2.68e-52	6	528	8	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.43e-50	2	527	34	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	2.26e-66	2	527	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.26e-66	2	527	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	2.37e-63	5	528	41	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	9.36e-63	5	529	15	618	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	6.83e-59	5	528	15	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000002

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_436503-t37_1-p1.