CAZyme Information: P170DRAFT_435569-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_435569-t37_1-p1
• CAZy Family: GH3
• CAZyme Description: 1,3-beta-glucanosyltransferase gel3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		58044.80	4.6972

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:1417061-1418854(+)

Full Sequence      

MKFSTALAGASLMGSALAKLPAIESKGNKLFFSNNGTEFFIRGVAYQQEYQANGSTSDNK
DYKDPLVSLDNCERDIPYLKDLRTNVIRTYAVDPKGDHDACMKALDEAGIYLITDLSAPS
ESIIDQDPKWDVDLYARYTSVIDAFANYTNVIGFFAGNEVAHKKNYTNSMAFVKAAVRDT
KKYIKAKDYRTSLLVGYATDDNADTREDLSQYMVCGDEDARIDMFGYNIYEWCGDSSFDQ
SGYKARTEEFKNYPVPAFFSEYGCIDPQPRKFGDVPTLFGPKMNDVWSGGIVYMYFQEDN
NYGLVSVDGDKVSTRKDYSYLSSQMQKVTATGVKSADYSAKTAEASSCPKVGKDWEAAEK
LPPSPNPDLCECMVKSLSCKVKDSVKSKAYKDQFDYICAQVDCGGIQADATKGKYGAYSV
CDAKQQLSFVMDLFYQQSSDKSQACDFSGKAETQDATEAKGTCASLMKDAGKKGTGTVTA
SPTAGGAGAASTGDSSSTSEGAAGVTSPSAVHVGNWQFGAYLVSALVAAAGMIML

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	18	328	8e-130	0.9903846153846154
CBM43	378	463	1.8e-20	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	1.71e-150	14	328	3	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	1.16e-29	377	451	1	75	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	3.52e-19	377	465	1	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
397119	Glyco_hydro_2_C	4.44e-06	35	263	11	211	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	0.001	23	204	320	481	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD81806.1|CBM43|GH72	1.16e-255	1	535	1	544
QMW27418.1|CBM43|GH72	1.16e-255	1	535	1	544
QMW39489.1|CBM43|GH72	1.16e-255	1	535	1	544
UDD55279.1|CBM43|GH72	1.16e-255	1	535	1	544
BCS16538.1|CBM43|GH72	1.49e-242	1	535	1	537

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	3.27e-116	14	450	27	471	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	9.19e-116	14	450	27	471	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	9.19e-116	14	450	27	471	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XVI5|GEL4_ASPFC	1.85e-241	1	535	1	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	1.85e-241	1	535	1	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|P0C955|GEL3_ASPFU	1.64e-174	1	485	1	483	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	1.82e-174	1	485	1	483	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1
sp|P56092|EPD1_CANMA	1.80e-172	3	478	7	476	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000390	0.999550	CS pos: 18-19. Pr: 0.9691

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_435569-t37_1-p1.