CAZyme Information: P170DRAFT_435281-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_435281-t37_1-p1
• CAZy Family: GH3
• CAZyme Description: putative cytochrome c peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MSFO01000003|CGC8	35187.50	5.7054

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:563863-564918(+)

Full Sequence      

MSNPGDYSAVRRDIVAQLKKPDYDDGSAGPVFVRLAWHSAGTYDAESDTGGTNGAGMRYE
AEGGDPANAGLQHGRAFLEPVKEKNPWITYSDLWTLAGVVAVEEMGGPKVAWKPGRTDLV
DDSKVPPRGRLPDGAQGADHLRFIFYRMGFNDQEIVALAGGHNLGRCHMDRSGFEGPWVN
NPTRFSNQFFKLLLKLEWKPRTLSNGVQQFNYVDPDADEDDEPLMMLPTDISLIIDPSFR
PWVERYAEDKDLFFDHFAKVFAKLIELGIRRDEKGVIVNTDNVKGGYVSAAKKSNTATGP
PKNEGGCPRAQGGCPRARL

Enzyme Prediction     

No EC number prediction in P170DRAFT_435281-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	10	268	1.7e-55	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	1.86e-137	1	272	7	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	1.54e-88	11	284	18	259	L-ascorbate peroxidase
178467	PLN02879	2.10e-72	29	273	34	251	L-ascorbate peroxidase
166005	PLN02364	1.86e-69	27	268	31	246	L-ascorbate peroxidase 1
223453	KatG	6.62e-65	6	269	68	417	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01357.1|AA2	1.25e-205	1	302	1	302
BCS13101.1|AA2	1.25e-205	1	302	1	302
QMW47926.1|AA2	8.09e-204	1	307	1	307
QRD93209.1|AA2	8.09e-204	1	307	1	307
QMW35864.1|AA2	8.09e-204	1	307	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JCI_A	9.21e-77	6	269	18	274	Chain A, Cytochrome C Peroxidase [Saccharomyces cerevisiae]
1JDR_A	2.09e-75	6	269	18	274	Chain A, Cytochrome c Peroxidase [Saccharomyces cerevisiae]
4A71_A	6.29e-75	6	269	20	276	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]
3M23_A	1.08e-74	6	269	15	271	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
5EJT_A	1.18e-74	6	269	18	274	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B1Z0|CCPR2_EMENI	1.87e-200	1	302	1	302	Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN5440 PE=3 SV=1
sp|Q4WLG9|CCPR2_ASPFU	7.06e-196	1	306	1	306	Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_6G13570 PE=3 SV=1
sp|Q4PD66|CCPR2_USTMA	1.13e-159	1	306	1	307	Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP2 PE=3 SV=1
sp|Q4HWQ2|CCPR2_GIBZE	1.57e-150	2	307	14	322	Putative heme-binding peroxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FGRRES_10606 PE=3 SV=1
sp|A4R606|CCPR2_MAGO7	5.46e-146	2	293	3	292	Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGG_10368 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_435281-t37_1-p1.