CAZyme Information: P170DRAFT_434272-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_434272-t37_1-p1
• CAZy Family: GH3
• CAZyme Description: putative class V chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	MSFO01000002|CGC33	46936.56	4.6193

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:3380536-3381958(+)

Full Sequence      

MRFNLNLNLLLAPAITALRFAMYVDQYHTVGLPGTETTGAVTHAIMAFAPASLFNSESEP
TYKPFESIETFRARFNPGTKIMFAVGGWGDTSEFGKGAKDEASRQRFAKNVAAVVNRGGF
DGVDIDWEYPGGNGDDYKKVPNSEKTSEIETYPQFLAAIRSAIGKDKLLSIAVPGKRVDM
IAFTKEQGPKIFESVDMVNVMSYDLMNRRNNVTVHHSSVVDSLDSVHAYQEVGLTGDKIN
LGVAYYAKWFTTKPGCEEDHPLGCEVEPLETADGGDTGKSGVLTFEASTMAEAPPNLKES
TDMTCGFNAGTFCPKGTCCSQYGNCGTGDDFCQTGCLSDYGECKGLSVLDSWRKALKDST
TDEKAGGEYYFDEPNRLFWTWDTAATIARKFRDIVDQEKLGGVMAWSLGEDTLAWEHVEA
MSEGVNARK

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	40	414	3.7e-53	0.8412162162162162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	6.22e-78	19	411	1	307	Glycosyl hydrolases family 18.
214753	Glyco_18	1.93e-49	41	411	26	334	Glyco_18 domain.
119349	GH18_chitinase-like	2.74e-43	20	205	1	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119365	GH18_chitinase	8.80e-40	76	411	82	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	8.85e-30	65	411	114	423	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD94346.1|CBM18|GH18	5.44e-213	12	428	14	430
QMW33929.1|CBM18|GH18	5.44e-213	12	428	14	430
QMW45983.1|CBM18|GH18	5.44e-213	12	428	14	430
BCS06705.1|CBM18|GH18	5.58e-213	15	428	6	422
BCR94095.1|CBM18|GH18	7.45e-213	15	428	14	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TSB_AAA	7.02e-19	77	248	89	263	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	8.34e-19	77	248	108	282	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6KXN_A	2.12e-16	76	246	73	257	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KST_A	2.12e-16	76	246	73	257	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
4W5U_A	2.70e-16	59	425	114	407	Crystal structure of chitinase 40 from thermophilic bacteria Streptomyces thermoviolaceus. [Streptomyces thermoviolaceus],4W5U_B Crystal structure of chitinase 40 from thermophilic bacteria Streptomyces thermoviolaceus. [Streptomyces thermoviolaceus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9D7Q1|CHIT1_MOUSE	3.06e-17	25	292	32	311	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|A6N6J0|CHI46_TRIHA	6.23e-17	76	311	120	355	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|P32470|CHI1_APHAL	8.04e-17	12	255	39	302	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|P11220|CHIT_STRPL	1.88e-16	59	425	314	609	Chitinase 63 OS=Streptomyces plicatus OX=1922 GN=chtA PE=1 SV=2
sp|P36909|CHIT_STRLI	1.07e-15	59	417	313	603	Chitinase C OS=Streptomyces lividans OX=1916 GN=chiC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.911664	0.088335

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_434272-t37_1-p1.