CAZyme Information: P170DRAFT_432933-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_432933-t37_1-p1
• CAZy Family: GH28
• CAZyme Description: acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MSFO01000001|CGC28	45989.26	5.5051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:5140728-5142515(+)

Full Sequence      

MRFAPLLWSFVSSSLLASANILENGQERLNPWPGQAPNVSLDDSWRNYDAGAPEIAYKGR
WDSKHIGWWSAPGFKTEFTGDRLAVSFGEHTTEGVLVAYRIGSLDWLFSNVTADTTYQFV
SPETDVGEKPVGDPKVFELRVTNWGRGAQIAGVSVASDAHLNRVENFKRRVEIIGGSLAS
GQYGTYETLSSWAWLYGAGLGNAEFDITAYPGACLADMKCYGGNVHGMPWWWHRASDPGT
RAREMYDHDPEEFDVRGDQPADLVIIQMGGNDHRSPNEISGPDFYHDYIRLIDDVHSIWP
KAVVVVMTQWGVWTKTGTEYVPNSVYESEIKRVHDHYKEKGFVHWFDTAGILQHNDINPK
NHPTDVGHIKLASHLLQWTRMIMRWPLEPTGEVQHGTEYWNNMQQY

Enzyme Prediction     

No EC number prediction in P170DRAFT_432933-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	185	377	8.4e-16	0.8564593301435407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	3.54e-46	170	380	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	1.43e-17	171	377	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	1.76e-11	196	368	8	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK40140.1|CE0	6.22e-205	1	406	1	407
BCS23119.1|CE0	4.67e-198	1	406	1	409
ABF50860.1|CE0|3.1.1.-	4.21e-197	6	406	11	402
EAA63262.1|CE0	1.22e-184	6	406	11	392
QMW34907.1|CE0	3.44e-164	1	406	1	398

PDB Hits     

P170DRAFT_432933-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P170DRAFT_432933-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000311	0.999672	CS pos: 19-20. Pr: 0.9558

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_432933-t37_1-p1.