CAZyme Information: P170DRAFT_427710-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_427710-t37_1-p1
• CAZy Family: GH28
• CAZyme Description: lysozyme-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
171		18495.16	7.6328

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:269882-270452(+)

Full Sequence      

MKIAALFPLLALAAALPASIQQRGIIRAAVELIGHLEGFRGNFYWIQGHKTVGYGHDCVA
KKDCHTISVPLSEPQAADLLSNDLSEFENCVCAMPNAKELNAHQYGALVSFAYNTGCGGL
QSSWHGAMSQKNFHGICEQLPGTNTLGGLLNIRRQKESHFCKQPTEKPSGC

Enzyme Prediction     

No EC number prediction in P170DRAFT_427710-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	27	149	7.4e-24	0.927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	1.94e-25	29	157	1	131	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	3.91e-22	28	161	5	139	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	1.06e-16	24	164	6	150	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
381619	endolysin_R21-like	1.88e-10	28	161	7	141	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
395766	Phage_lysozyme	1.18e-07	51	155	3	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65990.1|GH24	3.55e-67	13	171	15	173
QRD92247.1|GH24	5.04e-67	13	171	15	173
QMW36689.1|GH24	5.04e-67	13	171	15	173
QMW48745.1|GH24	5.04e-67	13	171	15	173
UDD66015.1|GH24	5.04e-67	13	171	15	173

PDB Hits     

P170DRAFT_427710-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P51728|ENLYS_BPHC1	4.83e-09	21	161	31	183	SAR-endolysin OS=Haemophilus phage HP1 (strain HP1c1) OX=1289570 GN=lys PE=3 SV=1
sp|Q37896|ENLYS_BPB03	1.90e-08	25	160	3	142	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999714	CS pos: 23-24. Pr: 0.9365

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_427710-t37_1-p1.