CAZyme Information: P170DRAFT_421558-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_421558-t37_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		54521.30	5.5976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:3872528-3873976(-)

Full Sequence      

MLLKGGEKPRPRGASWVWRKKLLRFVVAICLVGGFTFLLWPHLGREKIVMEDPVSNITVT
SGVHCEPDFELLARLDIKKLSGYVKREIVATPTSDTLPIRQHLDTPLFEPLESPNPVSTP
QSQDDCLIPKPVSLQVPKPPVRVDASHIDFGVATTLGRLNDSIDAFAHWAGYTQTRIFAL
IEPDKEERIKEVQMKADALGINLFVEESDEEYQRRYFSLVAHLEHNMQRKTQWSCVIDDD
TFFLSMPELVKALGEYDARQPMYVGGLSESIPQVGAFGLMGFGGAGVFMSRPLIQQISEP
AIFNDCLNTGHTGDRRISLCVYQNTPTRLTINHRLRQLDMTDDVSGFFEVNRLPPLSVHH
WKSWFHTDMAKLSVIGELCGDGCLLRQFEFGDGWILTNGFSVMKYSVDLDPNDPSMEVTW
GGQNGANIDSYLHELGPLRPKDNDKFSYAMVDTVLDGNKVRQYYVHRDPEKGDQLLELIW
RA

Enzyme Prediction     

No EC number prediction in P170DRAFT_421558-t37_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	2.19e-09	232	360	212	341	hypothetical protein; Provisional
367085	Fringe	2.96e-08	199	298	51	160	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	0.006	280	360	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE58287.1|GT31	6.08e-258	1	482	1	484
UDD56605.1|GT31	6.08e-258	1	482	1	484
QMW40633.1|GT31	3.50e-257	1	482	1	484
QRD83076.1|GT31	2.02e-256	1	482	1	484
QMW28562.1|GT31	2.02e-256	1	482	1	484

PDB Hits     

P170DRAFT_421558-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P170DRAFT_421558-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000000	0.000014

TMHMM  Annotations     

Start	End
22	44