CAZyme Information: P170DRAFT_419315-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_419315-t37_1-p1
• CAZy Family: GH2
• CAZyme Description: putative GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	MSFO01000011|CGC8	65594.87	6.5343

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000011:1020423-1022464(+)

Full Sequence      

MDSNDVYDYVICGGGTTGCVVAGRLAENSNVRILVIEAGQHNKDLENVHMAGGWSNNFDS
ETDWNIVTPSMKGVDNRQVKLSRGRFLGGSSGCNGTLCVRGSPQDFDDWGLEGWSGSEVF
AAMKKAETFHPKDWHQADIKSHGFSGPLHTEPHDLAPIGNLILDSFVSQGLPLDHDMFST
GETPHGCGHVMRTVHKGIRSTSADFITKEYHRANVTILTDTTVDRVILEQGANGPRATGA
VGVFPDGSSRTFKARKEVIISGGAYCSPAVLMRSGIGARQELEDIGIPCSVDLPGVGKNL
MDHLIVFMFYETEKPGLTNDHHVYHENNFEKTYAQWKEHKSGFLSTFPFGCFAFARLDDR
LKNEPLWKNAPREPGRDPMGLTPKQPNIEFFTTECYGGPKQFDQFPINNKHAFSMIAELF
APKSRGTVTLKSKDPTENPVVDCNYLADPMDLLVLSEACRFGNEIVMQGAGTKDIVKGSW
PPNLSHHTYKTREEWVPYVKENATTCYHASGTCAMGSDDNPMAVLDNKLRVKGVAGLRVA
DTSAMPVLCGGHTQMTAYGIGERCADFIKETWNEGRTGERRRQGERQGMAITRAHL

Enzyme Prediction     

No EC number prediction in P170DRAFT_419315-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	570	1.8e-161	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.56e-103	7	577	6	535	choline dehydrogenase; Validated
225186	BetA	5.52e-98	1	570	2	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	5.07e-63	8	568	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.31e-37	422	564	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.17e-32	74	305	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65288.1|AA3_2	0.0	3	573	5	575
QMW48130.1|AA3_2	0.0	3	573	5	575
QMW36070.1|AA3_2	0.0	3	573	5	575
QRD92967.1|AA3_2	0.0	3	573	5	584
BCS27972.1|AA3_2	0.0	2	572	6	576

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.18e-69	7	569	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.64e-69	7	569	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	2.29e-69	7	569	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	1.51e-65	7	573	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3LJP_A	6.78e-61	3	569	10	527	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	1.50e-77	7	569	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.25e-73	1	576	1	540	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	2.71e-72	7	568	5	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	2.71e-72	7	568	5	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	9.42e-70	4	568	2	530	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000003

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_419315-t37_1-p1.