CAZyme Information: P170DRAFT_419063-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_419063-t37_1-p1
• CAZy Family: GH2
• CAZyme Description: putative beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778		85375.86	5.8626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000011:561785-564706(+)

Full Sequence      

MVAGLFSKGLLLLGLCSLGAAQNGSKPLYKNPNAPVNDRVDDLLGRMTVEDKMGQLIQGD
ITNWMDADTGEFNYTGLVENMKWKAGMFYVGYPVPWDWIATNVKRAQDYLVHNTTLGIPA
FVQTESIHGFLIGNATIYNSPIGYGCSFNRDLIYKMGRLISQEALALGVNQLFAPVVDLA
RELRFGRVEETFGEDPYLAGEIGYYYTKGIQSLNVSAQVKHFAGFSQPEQGLNTAPVHGG
ERYLRTTWLPPFKRAIIDAGAWSVMSAYHSYDGIPAISNHHVLTEILREEWGYEYFVISD
AGATDRVCNAFHLCQSNPIDMDAVTLSVLPAGNDVEMGGGSFNFRKIPELVESGKLDIDT
VDTAVKRVLKAKFEMGLFENPYPGAPQSEWKKLIHSKEAVDLARKIDQESIVLLENHDNI
LPLKKGGDIAVIGPMAHGYMNYGDYVVYESQYRGVTPLDGIKKAVGKKANVHYAKGCERW
SNDESGFQEAVDAAKKSDVAVVVVGTWSRDQKELWAGLNATTGEHVDVNSLSLVGAQSSL
IKAITATGVPTIVVLSTGKPVTETWLSSNTSALIQQFYPSEEGGHALASVLFGDYNPSGK
LSVSFPRYVGDLPIYYDYLNSARTIGDAGQIHDNGTLEFGHQYVLGSPLAWYPFGHGKSY
SEFEYSDVRVSKTNVTDADTVTVSVKVKNTSKVKGTEVVQVYIQDEFASVVVPNKELKGF
EKVVIGAGKTKTVKIPIKVGDLGVWDVKMKYVVEPGKFIAWVGSSSEDIRGNATFWVR

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	337	9.1e-62	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.55e-172	31	775	26	762	beta-glucosidase BglX.
224389	BglX	9.55e-80	47	478	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.73e-73	116	737	79	742	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.80e-61	411	660	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.01e-59	48	371	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD57574.1|GH3	0.0	1	778	1	779
QMW32562.1|GH3	0.0	1	778	1	779
QMW44592.1|GH3	0.0	1	778	1	779
BAE62006.1|GH3|3.2.1.120	0.0	1	778	1	779
BCS20094.1|GH3	0.0	1	778	1	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	0.0	26	778	4	757	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	0.0	26	778	4	757	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5TF0_A	2.66e-121	40	770	13	744	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z87_A	9.18e-115	100	770	105	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.03e-113	40	770	14	745	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q56078|BGLX_SALTY	4.12e-124	15	770	4	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	4.74e-122	40	770	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	5.35e-119	113	767	60	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|T2KMH9|PLH34_FORAG	4.93e-106	29	770	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	1.69e-99	116	778	35	675	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000196	0.999785	CS pos: 21-22. Pr: 0.9720

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_419063-t37_1-p1.