CAZyme Information: P170DRAFT_416521-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_416521-t37_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856		93548.75	4.7251

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000009:92581-95256(-)

Full Sequence      

MAPSKNVKELLDQLILEEKVSLVSGADGWQTHEIPRLGIGSLKTTDGPAGARGKLSVGGS
KAIFLPAPVAQAATWSKTDVRAIGRVLMMEVQSKAAQIVLAPTMCCIRNPLGGRNFESFS
EDPFLSGTLAIEYVAGVQETGTVAATAKHFVANEQEFERFTVNAQISEKALREIYLRPFE
MLIKGPNPPGCIMTSYNSINGLHADMNSKIIQHTLRDEWQYKGLVMSDWGGTNSTAESLI
AGCDLEMPGPSERRGSKLLEALEKDNSGKLEAALELSCERIISLLGTMNLLGLSESAAVE
SRYGEEKSSTASTDIQTVRDVVGNGLVLLKNSNNILPLSSEKVAGKRVAFIGPNGQVGAA
GGGGSASMNPQYQSHPMEAFKQRAVELGVDIDVQYAIGCHNYRWLPLVSKSQWRVGGEDG
VLRLDFFDAPGCAGRLIETQYRDNSQMDLFDTAPAMLQGSIRPYSFRMSSTVTPRTTGRH
SFGVTSIGNSRLFINGALLIDNYDWTEPGEMFYSFGSAEVCHSIDMVANQTYEVILESSS
KTTNDPSPEESSTNVFGIQPSVRLGFLEEVPDNLVSDALQLAKRSDFTVAVIGLNEEWES
EGFDRQTMQLPGSQNELIQTLLTGMTQPSSLIIVNQSGSPVEMPWSDDAGTILQAWYGGQ
EAGNALADVLLGQKSPCGRLPMTWPRRYEDLPFSADAESWPGVNGQVCYKEDVEVGYRWY
PSHRVKPQWWLGEGLSYTTFSMKGPAIILHEAGLTFHVEVVNDGRIAGQDVIQAYSWLLG
RPEARQLVAFEKSSVLSPAESQTIRLQITFRDMAHWNESCWVLGKGAYMIGICENAGGAV
RVSHEFTIDEDMKWIP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	248	2.2e-59	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	6.99e-54	29	354	50	363	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	7.19e-48	57	817	113	734	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	6.39e-45	557	717	63	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	5.07e-40	10	803	56	738	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	8.71e-36	36	284	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95903.1|GH3	0.0	6	854	8	862
CEI68113.1|GH3	0.0	1	832	1	847
UPX44937.1|GH3	0.0	4	849	3	859
EGX50909.1|GH3	9.02e-206	5	854	18	843
AEO66128.1|GH3	4.84e-205	11	855	63	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.74e-148	6	854	5	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.28e-144	6	854	5	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
4I3G_A	1.96e-94	9	826	56	807	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
2X40_A	7.24e-91	5	856	2	721	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.01e-89	5	856	2	721	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	7.53e-169	7	832	11	823	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1DNN8|BGLJ_NEOFI	2.28e-162	7	830	14	838	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|P27034|BGLS_RHIRD	5.76e-160	7	817	2	778	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	4.33e-159	7	854	14	862	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	4.33e-159	7	854	14	862	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000001

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_416521-t37_1-p1.