CAZyme Information: P170DRAFT_413282-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_413282-t37_1-p1
• CAZy Family: GH18
• CAZyme Description: cutinase-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MSFO01000006|CGC17	31422.74	5.0180

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:3183878-3184997(+)

Full Sequence      

MKAAIALSLITAALAAPTKTVESRQLPGLGGSSSSSSGGLSGLSSLIPSGLAGGGSSGSS
SGGLPDLSKLLGGGSSSGSSSGGLPDLSSLLGGGSSSSDSSDSSDSSSSSGSDSSSDSSS
GSDSSSSSSGGLPDIGSLLGGGSGGSMTENDVAQNKGCKELTFIFARGTTEMGNMGSVVG
PPVAKNLNSLTGNQCAVQGVDYPADAAGNAMMGASGGPKMAEMVQKALKQCPKTKVVLGG
YSQGSMVVHNAASKLSEGQIAAAVLFGDPFKMQAVGKLDKSKTKEFCASGDPVCENGFNV
MAHLSYGGQAKEAAQFLVQAAGVGSS

Enzyme Prediction     

No EC number prediction in P170DRAFT_413282-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	158	319	1e-44	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	5.43e-46	158	320	2	172	Cutinase.
223477	YpfH	0.003	219	324	82	178	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD85183.1|CE5	3.54e-96	1	323	1	327
QMW41006.1|CE5	7.46e-94	1	323	1	331
QMW28931.1|CE5	7.46e-94	1	323	1	331
UDD59214.1|CE5	4.04e-91	1	323	1	343
BAE58644.1|CE5	1.09e-89	149	323	36	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	4.11e-35	146	318	72	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	1.56e-23	147	322	10	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
5X88_A	3.17e-23	149	317	15	194	Chain A, cutinase [Malbranchea cinnamomea]
3QPD_A	8.92e-23	147	318	1	184	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5AJH_A	2.99e-22	145	321	18	209	Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_B Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_C Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	1.05e-85	145	323	47	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q8TGB8|CUTI_MONFR	4.91e-36	156	322	29	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	9.96e-36	156	323	29	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|A8QPD8|CUTI1_TRIHA	1.30e-34	146	317	72	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	1.82e-34	146	318	72	244	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999692	CS pos: 24-25. Pr: 0.9291

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_413282-t37_1-p1.