CAZyme Information: P170DRAFT_409438-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_409438-t37_1-p1
• CAZy Family: GH17
• CAZyme Description: putative choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		66716.03	5.5947

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000004:3839211-3841185(-)

Full Sequence      

MTRLQDFAAHQFDYIIIGGGTAGLVLARRLSDRADLCVGVVEAGPAAPEEPAINIPGRYG
ETLGGKYDWKFETTEQPGLDGRRVPCPRGKVLGGTSALNFMAWNRGNREDYDAWAELGNE
GWGWEDLLPFFKRSETFHAPDSSHQESCRSYYQADVHGVNGPVQTTHIREYGPAHQFWHD
TLNNLNVETSPDSLGGRNSGAWNMVCSIDPVKQARSYSATAYYYPIKQRPNLVVLEATVT
EIICERTEDDWRAAGVRVRCDGKITDIPASKEVVLCAGSIQSPQLLELSGIGSRSVLNAA
GIPIRVENPNVGENLQDHMMTATIFEIDHSLPTRDDILSDAELRKSANNEYATSRTGPWT
ILPCSIAYCPLSTFVSPEELSYFRSRALLIAQETGHPRDEILARQFQADAHLGQIEYLFD
VGNWSPFFQSEPSKKYGTMLQMLQYPFSRGSIHIPPRSGGRTTADDHPTIDPQIYLGPGE
IDRKVMTMAQKFGKTICETEPLSSMMQARTAPPDDDYDRFVVHNTITDWHPIGTCAMGGK
QGDKAGVVDHRLRVYGVRGLRVADASVMPLQVGAHIQATVYAIAEKAAAMILDDIDRSPR
AGKA

Enzyme Prediction     

No EC number prediction in P170DRAFT_409438-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	593	1.5e-179	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.17e-107	8	600	4	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.46e-96	8	592	2	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.33e-39	80	319	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.23e-31	446	587	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	7.38e-20	10	604	54	584	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD87580.1|AA3_2	3.80e-303	1	597	1	610
QMW26329.1|AA3_2	3.80e-303	1	597	1	610
UCK58874.1|AA3_2	1.09e-302	1	597	1	610
QMW38412.1|AA3_2	1.08e-279	1	597	1	584
QVM12647.1|AA3_2	2.20e-217	3	594	7	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.20e-79	12	594	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.43e-71	12	591	6	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	7.95e-69	12	594	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.27e-68	12	594	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	2.49e-66	12	591	41	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	2.64e-101	2	594	4	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	7.52e-101	3	594	5	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	7.52e-101	3	594	5	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	2.72e-86	5	596	33	634	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.87e-85	6	592	41	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999955	0.000089

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_409438-t37_1-p1.