CAZyme Information: P170DRAFT_408083-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_408083-t37_1-p1
• CAZy Family: GH17
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		41440.55	4.6576

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000004:1494916-1496239(+)

Full Sequence      

MKAAVLSSLLAFSAQTAYAQVKGTPQGFAAGTTGGGDATAATPSSIEELTQWITDDTPRT
ILIDRTWDFAGTEGTTSGQCCSTRTTTCEGGTSKGQAWIQDSCDDGTWVSCTYDNAARSP
LDIGSNKSIVGVGSGAVLKGKGLRVRGGNKNVIIQNIHITNLNPQYVWGGDALTLDGADQ
VWIDHNKFSLTGRQHIVSGWGQAGRVTISNNEFDGRSEWSAGCNGKHYWTMLLIGENDQY
TFSGNWVHDVSGRAPHMGTDNTDSQIFFHGVNNYFQDIGGHSFDIDTNTHVLLEGNYFDN
VDTPLTQTSLESGALIYNVPTVDSASACTSDLGYICEWNRLSNSGEWTSKTDQAVLSKAA
EFKDSLIDHIGVADVPATVKANAGVGKI

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	111	300	1.3e-84	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.65e-42	109	302	2	190	Amb_all domain.
226384	PelB	3.55e-18	105	388	82	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.66e-15	114	298	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS20248.1|PL1_4	1.56e-221	1	388	1	387
UDD64891.1|PL1_4	1.10e-201	19	388	20	391
QMW47813.1|PL1_4	6.35e-201	19	388	20	391
QRD93342.1|PL1_4	6.35e-201	19	388	20	391
QMW35751.1|PL1_4	6.35e-201	19	388	20	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	4.34e-87	19	387	1	359	Pectin Lyase B [Aspergillus niger]
1IDJ_A	5.50e-85	21	388	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	1.10e-84	21	388	3	359	Pectin Lyase A [Aspergillus niger]
1PCL_A	1.06e-07	114	298	69	276	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1JRG_A	1.92e-07	106	298	68	287	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CFF7|PELF1_ASPTN	4.43e-233	1	388	1	388	Probable pectin lyase F-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-1 PE=3 SV=1
sp|A1DEH0|PELF_NEOFI	2.96e-219	1	388	1	386	Probable pectin lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelF PE=3 SV=1
sp|B0Y0L8|PELF_ASPFC	8.06e-217	1	388	1	386	Probable pectin lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelE PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	8.07e-117	16	388	17	380	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5B3J8|PELF_EMENI	5.77e-113	4	388	2	378	Probable pectin lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000454	0.999530	CS pos: 19-20. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_408083-t37_1-p1.