CAZyme Information: P170DRAFT_404258-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_404258-t37_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712	MSFO01000002|CGC43	75551.58	3.6529

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:5381105-5383805(+)

Full Sequence      

MYAFAGVFVLLCAWVDAQAFLAEEDGTVLSVGVPDTLSTACQTALNQTTQCNSTLSFVAF
DGLFPSSDVLAAICTDSCKESLQSFRSQEVEACGDEYYHVDGKLVPASYSVDQLLFTYTY
TCLQDGTTNVYCAPLIDEWSQAGPTAEQSCSECMLKTFQVELNSPFGYDDEFASYYRSLT
SSCGVSDYPITLPPSYTVTATSSTSTTTSVTPSISCASKYAVKKGDDCSSVSQAQQVSEA
MLRYNNEIAADCSNFPDVGTSLCLPATCDVYTLQANQTCYDIALAYNSTFTVTQLISWNP
DINRDCSNLEVMVGTHLCVSAPGDTGESSVTMTPTSTIATPIAAPTNVANGTNTRCAKYY
EAVPGDTCSSITVKMAISVADFYFLNPEINSTSCSNLLAGSSYCVQAVGDIATYSGYGGY
SNPCVTLVPLPSSCIATAVTTTDSGWTFPTYTTNTTQPTPLPLAAGTWSNCSTYTQYIAP
VRNASTINSCYVVASMYDVDVTDFVSSNPSLSYDQDADDPNDCQLKPGYQYCLQLSKPTT
TPTTTTTTTATSTTSSGQSTSTGSNGQPTPLPIQDGMTTSCGAFYLVKTDDSCYDIAASN
NIAIDKLYTWNPALNGDCTGLYPNYYICVGSIGSTTATTTTTTTSGGVSTPTPTQSGMIS
GCKSFYFVQSGDSCYDIAADNGIALDTLYLWNPALNGDCSGLWPDYYICVGL

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	2.07e-10	665	708	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.32e-07	584	627	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	3.69e-06	665	710	1	44	Lysin motif.
197609	LysM	5.52e-06	584	629	1	44	Lysin motif.
212030	LysM	6.01e-06	270	319	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY65640.1|CBM50	1.30e-254	16	711	20	702
QPG98790.1|CBM50	5.98e-170	6	630	12	553
UKZ60082.1|CBM50	1.04e-126	11	533	13	528
QKX60067.1|CBM50	2.90e-117	425	712	1	288
BCR84334.1|CBM50	1.00e-93	37	532	35	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BUM_A	9.20e-06	662	710	2	48	Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense],5BUM_B Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AVW3|LYSM5_ARTBC	4.81e-36	302	630	207	535	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4ALG0|LYSM1_ARTBC	1.16e-33	299	711	98	456	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B5F9|PGDA_ARTBC	1.53e-14	654	712	379	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4AY86|LYSM6_ARTBC	4.96e-12	38	408	38	422	LysM domain-containing protein ARB_01155/01156 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01155/01156 PE=3 SV=2
sp|D4AZ68|LYSM3_ARTBC	6.88e-12	568	710	254	406	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999769	CS pos: 19-20. Pr: 0.9612

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_404258-t37_1-p1.