CAZyme Information: P170DRAFT_391194-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_391194-t37_1-p1
• CAZy Family: GH125
• CAZyme Description: putative alpha-galactosidase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647	MSFO01000008|CGC15	70102.23	5.0711

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000008:379736-381874(-)

Full Sequence      

MIPAALGTLQPRLQDGLARTPPMGWNTYNHYNCRPNEAIVRSNAKALVDTGLAELGYHYV
TVDCGWTVSERTEKGLTWNETLFPEGFPALGKYLHDLGLLFGAYGDSGIKLCGSPPDNIG
NLYHEEEDTKAYASWGVDALKYDNCFSDAATDYPNVNYEPSTSPHPRFVKMADALAQTNR
SILFQVCEWGIDFPALWAPSIGHTWRIGNDILPAWRSIFRTLNQAVPQTSFAGPGQWPDL
DMLEVGIGALTTPEEQTHFSLWAILKSPLTIGGVLKDENTSIGEESLAILKNKDVIGYNQ
DKLGVSASFRRRWTDEGYEVWSGPLSGGRTVAALINWKDEARDLTLNLPDIGLQFAGSLR
NIWDGSTARDVKSSYTARVEPHGTILVELQDTIVSRQYPAKSFASSNGASTTFKSIYANT
TSSKHTLTINFSEPASSSSKITLETTAGNGTISKAIPESSEQVSLNLPLVAGSSNSITIK
NSPPIESIQVNSPRGTYYPSTNFTLGGSARKDSCGSGFCQPVGSRIRYISPNGTARAVVP
ATAGSKYIEIDYTNNDVAFDSAWGWGTNTRNLTVAINGGKPVRVEAPLSGRHSELFGPGL
GWWDTATMGVLTQGWKDGDNEVVIGNVGGEQGFESYGADFVGLKVYS

Enzyme Prediction     

EC	3.2.1.22:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	120	367	1.5e-66	0.9737991266375546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	7.41e-112	21	301	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
166449	PLN02808	1.99e-102	13	382	24	376	alpha-galactosidase
177874	PLN02229	3.44e-100	7	384	51	412	alpha-galactosidase
178295	PLN02692	2.25e-92	13	382	48	401	alpha-galactosidase
374582	Melibiase_2	3.46e-56	20	301	1	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD59118.1|CBM35|GH27	0.0	1	645	10	656
QMW29010.1|CBM35|GH27	0.0	1	645	10	656
QMW41085.1|CBM35|GH27	0.0	1	645	10	656
BCR99189.1|CBM35|GH27	0.0	8	645	20	659
QRD85275.1|CBM35|GH27	0.0	1	645	10	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UAS_A	1.07e-86	14	382	2	352	Chain A, alpha-galactosidase [Oryza sativa]
6F4C_B	2.56e-84	13	382	1	353	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
3A5V_A	9.55e-74	15	395	3	396	Crystal structure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
3LRK_A	5.70e-64	15	351	24	376	Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRL_A Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae]
4OGZ_A	2.58e-63	5	381	80	464	Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343],4OGZ_B Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8N7Z0|AGALD_ASPFN	0.0	1	645	10	654	Probable alpha-galactosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aglD PE=3 SV=1
sp|Q0CVX4|AGALD_ASPTN	0.0	1	646	10	654	Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglD PE=3 SV=2
sp|Q2UI87|AGALD_ASPOR	0.0	1	645	10	656	Probable alpha-galactosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglD PE=3 SV=2
sp|A1D9S3|AGALD_NEOFI	0.0	7	645	17	646	Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aglD PE=3 SV=1
sp|A4DA70|AGALD_ASPFU	0.0	7	645	17	646	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=aglD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994966	0.005089

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_391194-t37_1-p1.