CAZyme Information: P170DRAFT_387855-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_387855-t37_1-p1
• CAZy Family: GH11
• CAZyme Description: putativeoxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666	MSFO01000006|CGC12	74547.17	7.0213

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:1557019-1559661(+)

Full Sequence      

MTIPEEVDIIICGGGSSGCVPAGRLANLDHNLSVLLIEAGEDNLNNPWVYRPGIYPRNMK
LDSKTASFYYSRPSEHLDGRRAVVPCANVLGGGSSINFMMYTRASASDYDDWQAPGWKTD
ELIPLMKKHETYQRACNNRDIHGFEGPIKVSFGNYTYPIKEDFLRAAESQDIPVTDDLQD
LKTGHGAEHWLKWINRDTGRRSDAAHAYVHSTRARHSNLHLKCNTKVDKIIIENGRAVGV
ATVPTKPLDGRDPPRRIFRARKQIILSSGTLSSPLVLQRSGVGDPDKLRQVGIKPLVNLP
GVGRNFQDHYLTFSVYRAKPDVESFDDFVRGDPEVQKKVYEEWNLKGTGPLATNGIDAGV
KIRPTQKELDEMKKWPTPEFVDGWESYFKNKPDKPVMHYSVISGWFGDHMLMPPGKFFTM
FHFLEYPFSRGQTHVQSPDPYENPDFDAGFMNDKRDMAAMVWGYIKSRETARRMGSYAGE
VTSHHPLYAYDSPARAFDMDLATTKAYAGVNHLSAGIQHGSWSQPLEPGKAPSSVHLNSN
QQETRDTLQYSKEDIKEIEKWIQRHVETTWHCLGTCSMAPREGSSIAKHGGVVDERLNVY
GVKGLKVCDLSICPDNVGCNTFSTALLIGEKCAMLTAEDLGYSGEALDMKVPNYHAPGEF
ANLSRL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	641	2.4e-257	0.9983050847457627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.26e-82	1	639	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.88e-79	5	633	4	528	choline dehydrogenase; Validated
366272	GMC_oxred_N	3.95e-48	78	310	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	8.65e-26	427	632	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.34e-15	8	629	57	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39314.1|AA3_3	0.0	1	666	1	666
QMW27243.1|AA3_3	0.0	1	666	1	666
QRD81611.1|AA3_3	0.0	1	666	1	666
UDD55076.1|AA3_3	0.0	1	666	1	666
AFP17823.1|AA3_3|1.1.3.13	0.0	1	666	1	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HSA_A	0.0	1	654	1	650	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6H3G_A	6.10e-244	4	657	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	9.94e-243	4	657	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5OC1_A	6.63e-48	6	639	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.25e-47	6	639	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F2R038|ALOX2_KOMPC	0.0	1	654	1	650	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|Q00922|ALOX_CANBO	0.0	1	654	1	650	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	0.0	1	654	1	650	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|F2QY27|ALOX1_KOMPC	0.0	1	654	1	650	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04841|ALOX_PICAN	0.0	1	654	1	651	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000013

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_387855-t37_1-p1.