CAZyme Information: P170DRAFT_379867-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_379867-t37_1-p1
• CAZy Family: CE5
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856	MSFO01000002|CGC38	93090.62	4.6195

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:5320935-5323505(-)

Full Sequence      

MCDPTSPVIDHLLNALTLEEKVSLLAGQNMWETAAIDRLNIPALRMTDGPAGARGSKWNY
GSPTTFIPCGISLAATWDLDMIERIGTVLGHETQRQGCKVLLAPTMNLSRSPLGGRNFEG
YGEDPFLVGSISRAIIRGIQRNGVGACMKHFILNDTETRRFNVDQKVDERTLREVYMKPF
VMALDADPWTAMVSYPLINGLHADENPAILPQLLRKELQFNRLVMSDWGGCNSTVESLIA
TTDLEMPGPPVRRGERLIKAIKDGHIDELQHVNPSVVRVLQLLEKAHLLPSLPENKDCST
SLPSTEESSMDTPALQKIARETAQGGLVLLKNDDILPLQPSSIKKVAIIGPNARRPTAGG
SGSAAVNPLYITTPEECLKEALEATNPNIEVGYEQGLPFTIRPPLLGDSVTVAGSSQQGV
QVDFYAGHAFEGPVESTSIWPNSLVYMMSDGDVPPSLKGKPYCYRVTGNIVVHTAGQYTL
SVGNTGKAKVFIDDELVIDNTEWTKVAPSNGFLGCSSPDAIVELTLASNRPYALRVDNVA
TLPPLEKCDNTLFPNVSGLRLGLALHEDEQAMFDRAVQAAGDSDVALLVIGHNKDSEGEG
GDRKSLNLPGRMDELVKAVCARNANTVVIIQAASAVSMDWADDPAAIVLSWYQGQENGNA
LADVLLGACNFSGKTPITFPRRLIDHGSSEWHPAEAEQDRSVIGEKVLVGYRSFEEQGIE
PLWPFGFGLSYTSFVLSNIRLENSIIKASADSKLTVCASVTNIGILDGHEVLQIYLSPSS
IIRSMGLVSYPKTLAGFSKVWVQAGETRDVEIEVQGDELRWYDEETSQWRIDPGGYTCYV
GTSVTDIDAQLSFEMQ

Enzyme Prediction     

No EC number prediction in P170DRAFT_379867-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	247	1.1e-61	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.00e-72	9	856	38	765	beta-glucosidase BglX.
224389	BglX	1.81e-60	28	353	47	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	8.20e-44	567	731	75	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	7.23e-38	38	282	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	7.93e-29	2	814	43	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP99712.1|GH3	0.0	3	855	4	845
QMW31943.1|GH3	0.0	9	855	9	851
QRD91011.1|GH3	0.0	9	855	11	853
QMW43976.1|GH3	0.0	9	855	9	851
BAE61700.1|GH3	0.0	9	855	9	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.49e-134	9	856	6	837	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.51e-130	9	856	6	837	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.76e-109	9	847	5	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.11e-95	13	849	9	657	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.60e-89	11	847	56	820	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	3.08e-164	9	856	11	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	2.26e-159	8	855	1	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|B0XM94|BGLH_ASPFC	7.45e-149	9	856	7	821	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|Q4WL79|BGLH_ASPFU	7.45e-149	9	856	7	821	Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglH PE=3 SV=1
sp|A1CUR8|BGLH_ASPCL	2.07e-148	9	853	7	818	Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000001

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_379867-t37_1-p1.