CAZyme Information: P170DRAFT_379008-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_379008-t37_1-p1
• CAZy Family: CE5
• CAZyme Description: putative beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859	MSFO01000002|CGC15	94408.96	5.7761

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:4113158-4115941(-)

Full Sequence      

MQSSELRKNVGQLFAVGFHGLTPSPEIKTLIHDHGVGGIVLFKRNIQDAAQLQALTLALQ
EEAKAAGHEHPLFIGIDQENGWVTRISPPIAPQLPGAMALGATYDPELAYKVGAATGETL
RLFGINMNYAPVCDINSEPLNPVIGVRSFGDDPGYVGRFAGATAQGLREQKVVPTVKHFP
GHGDTAVDSHYGLPVIKKTRDQLEQCELRPFRRAVAEGIEAVMTAHISLPALGETELPAT
LSADALNILREDMQYDGMVVTDCLEMDGIRATYGTEQGAVLALGAGSDSIMICHTYNVQV
ASINRVIGAIESGEVSTVRLMDALRRVAKVKQAFLNWDTALQLQSLDGLIPINDKSVDLA
ANVYSKSATIVREKPGVLSKLFSESSTVLFLFPGEKTPAGGAVDGEGLGRKGSHNATEYL
EILKKQCPNATEVCYTEPGLSSEQWSLVEAVDVIVFTSINARESPYQRRVGLELAQRAQN
IVSIAACSPYDFLDDASIETYVTTYEPTVEAFFAAVKRMKGQEIVQKGQLPIGPLKPTPG
WIAVDDYVSSMDLLPVLALWKKALPTYPLLHESPERLLSRKNAHHFVVRGDTDLVGFCLL
YTEEKRDVTCGYLAVLAVDPKKQGLGVGTALIEACRSWLKKEFKNPRLELGSSFPRFWPG
IPTDLPSETQQFFVHRGFQLNPPSARSVDLYQDIRNFEVPVRYAARARERGYTFGPLKPE
DFLKGLSGQKRNFSDNEAWVQKFMDLDPTLYPSSIMTAWDYEGNQVAWALMLGSECDILR
QDWVFPPMCGPRTGLIGCVGVDKAHRKNGIGLALVGHAIENMKNRGIEGVFVDWVALDGW
YEQLGFEVWRSYRPGRMAL

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	68	291	3.2e-61	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.30e-87	6	428	3	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.19e-82	6	330	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	6.13e-47	26	294	17	281	beta-hexosaminidase; Provisional
185053	PRK15098	3.23e-13	6	331	47	353	beta-glucosidase BglX.
173926	NAT_SF	5.54e-08	585	641	1	56	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW40223.1|GH3	0.0	1	859	1	865
QMW28153.1|GH3	0.0	1	859	1	865
BCR85716.1|GH3	0.0	1	855	1	852
CAP94355.1|GH3	0.0	5	857	5	852
BCR93582.1|GH3	0.0	1	859	1	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	3.84e-152	6	855	9	856	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.44e-95	6	538	13	534	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3TEV_A	7.07e-58	11	329	19	329	The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
3BMX_A	5.18e-57	26	399	76	466	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.58e-56	26	399	50	440	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.66e-56	26	399	76	466	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	2.05e-55	22	331	50	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q87BR5|NAGZ_XYLFT	1.96e-40	13	341	1	315	Beta-hexosaminidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) OX=183190 GN=nagZ PE=3 SV=1
sp|B2I6G9|NAGZ_XYLF2	1.96e-40	13	341	1	315	Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) OX=405441 GN=nagZ PE=3 SV=1
sp|Q9PAZ0|NAGZ_XYLFA	1.24e-39	13	341	1	315	Beta-hexosaminidase OS=Xylella fastidiosa (strain 9a5c) OX=160492 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_379008-t37_1-p1.