CAZyme Information: P170DRAFT_372461-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_372461-t37_1-p1
• CAZy Family: CE3
• CAZyme Description: glycoside hydrolase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646	MSFO01000001|CGC22	72438.05	5.0837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:866384-868421(-)

Full Sequence      

MPVYPRPDFQRPSLTWSSLDGPWDFIFDDVDVGLSQRWHQTGIPASASQLSKRQIQVPYA
FQTPASGIGLYEAHEVLWYERTIHDIRTPDERAAGHTLKLRFGAVDYECAVWVDGRAVGG
HRGGHVPFDVDVSDAFASADDAPRRLTLRVRDSTEDLTQPRGKQYWGPVPQEIFYTPSSG
IWQSVWLESVPRWRLGDSSEGTVLRSDDIDGGQLHARVAVVDRPALVEGSVEIEATLDGV
AVSKSVAKLLREKDWVALDVDMRVPGASTLQTRAPFNVKGSWRNGVALWAPEHPILYDVA
IRLHSAQGNLLDEVNTTTGMRRVSWQTGDGTFRLNDKPIFQTLVLDQGYWPETGLTPPSQ
EALREDIEMALKVGINGCRKHQKVEDPVFYYWADRLGFLVWGEIANAYEFSDEYISRYNS
EWTEAVKRDINHPSIVAWTPFNESWAYTSLNDNVEQRNHIRSVYYLTKALDPTRPINDNC
GWEHVQTDLTTFHDYTDSPSLTATCADFENGILGQKSNRELFVGPIKSGSVVLDPGTQHK
PGAPVICSEFGGVNIIPSKGTAAGDRDWGYTTASDPEDFLGRLEKLVMGVVKGGHICGMV
YTQLCDIEQEVNGLYSYDREEKVPPHRVKAIMDAAHKYYFDHVAPK

Enzyme Prediction     

No EC number prediction in P170DRAFT_372461-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	12	515	1.8e-99	0.5159574468085106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.66e-36	18	552	14	487	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	5.54e-28	11	476	3	445	beta-D-glucuronidase; Provisional
236673	ebgA	7.51e-19	79	474	113	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	1.03e-14	179	476	207	485	beta-galactosidase.
397119	Glyco_hydro_2_C	5.84e-13	329	560	5	219	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD91609.1|GH2	0.0	1	646	1	649
QMW47280.1|GH2	0.0	1	646	1	649
QMW35218.1|GH2	0.0	1	646	1	649
CAK44902.1|GH2	0.0	1	646	1	648
UDD64307.1|GH2	0.0	1	646	1	641

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	4.13e-60	1	631	26	578	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
4JHZ_A	2.39e-19	10	551	8	508	Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]
3LPF_A	2.40e-19	10	551	8	508	Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPF_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPG_A Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],3LPG_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],5CZK_A Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12],5CZK_B Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12]
6D8K_A	3.11e-19	18	474	37	438	Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus],6D8K_B Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus],6D8K_C Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus],6D8K_D Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus]
3K4A_A	3.18e-19	10	551	8	508	Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O97524|BGLR_FELCA	9.62e-23	3	476	28	478	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|O18835|BGLR_CANLF	9.21e-22	3	476	28	478	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	4.72e-20	13	474	50	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|Q6D736|BGAL_PECAS	2.97e-19	11	481	55	500	Beta-galactosidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=lacZ PE=3 SV=1
sp|P77989|BGAL_THEP3	3.98e-19	55	475	35	411	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_372461-t37_1-p1.