CAZyme Information: P170DRAFT_368335-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_368335-t37_1-p1
• CAZy Family: CE16
• CAZyme Description: putative long chain fatty alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747	MSFO01000009|CGC12	81007.85	6.8665

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000009:1240116-1242463(-)

Full Sequence      

MTDQAIPYTPLDVQLPPVSSKEIFSEIQWTTLLSIADTVIPSIRGPSAPSSASSKVIPQS
QLNTTIAQLAAHIRDPDASTLAMRYLEENASSNLHFRDTIQRLFADYVNEEGRNGLGFIL
NALNSKAGSLILTGSVTPFQEQPFEIRDKIFSGWETSRLKPLRAVYRALTGIVKRTWITS
SPTLCPVLGFPRVPVHGKPADGFKYDFLQIPPGDEPETIETDVVIVGSGCGGSVAAKNLA
EAGYNVIVVEKSYHYSTKHYPMNFNEGFVSMFEAAGVTGTDDGSMGVFAGSTWGGGGTIN
WSAALQTQGYVREEWANYGLPFFTSLEFQNSLDRVCDRMGVSAEHTTQNISNNVLLEGAR
KLGYAAQPVPQNTGGQKHYCGHCTMGCHSAEKKGPTETFLADAACAGAVFMEGFNADKVL
FSNTKGGRVASGVQGTWTSRDAHLGRSGDGSVKRKVIIKAKKVVVSCGTLQSPLLLMRSG
IKNSQVGRNLHLHPVIVGGAVFDEETRPWEGGALTAVVNEFEDQDGHGHGVKIECLTMLP
AAFLPAFPWRDGLDYKLWAAKLSRMTGFITLTKDRGSGRVYPDPTDGRCRIDYTVSAFDR
KHMVESLVATAKIAYISGAKEFHTSCREMPPFIRQEDPAGVDESEGVNNAALQSWIAELR
RKTLDPERTLFACAHQMGSCRMGASPRTSVVDPDCQVWGTHGLYVVDASVFPSASGVNPM
VTNMAIADWASTRIAKSIEKEGLMARL

Enzyme Prediction     

No EC number prediction in P170DRAFT_368335-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	218	736	5.8e-64	0.9708029197080292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	5.35e-58	271	495	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	2.81e-47	222	736	9	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.65e-33	574	727	1	140	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	8.83e-16	221	735	1	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	1.02e-10	416	734	224	531	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	7.37e-200	9	741	10	737
UJO19303.1|AA3_1|AA8|CBM1	9.93e-14	214	734	264	805
XP_756097.1|AA3_1|AA8	4.84e-13	208	734	257	800
VBB79670.1|AA3_1|AA8	6.29e-13	212	734	240	786
CAP61651.1|AA3_1|AA8	1.09e-12	212	734	241	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	7.50e-10	216	734	225	763	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
7DVE_A	1.09e-07	458	738	263	508	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]
1NAA_A	5.84e-07	222	734	4	534	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	5.87e-07	222	734	9	539	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI4_A	1.40e-06	216	734	3	542	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	1.83e-90	116	741	96	749	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q9LW56|FAO3_ARATH	1.25e-88	219	738	231	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|B5WWZ8|FAO1_LOTJA	3.72e-85	219	741	235	747	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|O65709|FAO4A_ARATH	1.22e-82	219	741	222	725	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q9ZWB9|FAO1_ARATH	4.43e-80	88	740	71	754	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000002

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_368335-t37_1-p1.