CAZyme Information: P170DRAFT_366483-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_366483-t37_1-p1
• CAZy Family: CE12
• CAZyme Description: putative endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		24683.85	5.6029

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000008:725579-726340(-)

Full Sequence      

MVSFSSLLVALSAAVGVLSAPVEQAPEFPDLSFNGTLHELAERSTPSSTGWSNGYYYSFW
TDGGGDVTYTNGAGGSYTVQWSNVGNFVGGKGWNPGSTRTINYGGSFNPSGNGYLAIYGW
TQNPLIEYYIVESYGTYNPGSGGTYKGTVTSDGGTYDIYTSVRYNAPSIEGTKTFTQFWS
VRQSKRTGGSVTTANHFNAWGRLGMSLGNHNYQIVATEGYQSSGSASITVY

Enzyme Prediction     

EC	3.2.1.8:67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	53	229	3.8e-79	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	9.82e-112	53	227	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZD35662.1|GH11	4.65e-138	1	231	1	231
BCS20460.1|GH11	7.30e-138	1	231	1	224
ABN48478.1|GH11|3.2.1.8	1.63e-135	1	231	1	228
ABA40419.1|GH11	1.63e-135	1	231	1	228
QZB01318.1|GH11	1.89e-134	1	231	1	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HIX_A	6.05e-93	45	230	5	189	Crystallographic Analyses Of Family 11 Endo-Beta-1,4- Xylanase Xyl1 From Streptomyces Sp. S38 [Streptomyces sp. S38],1HIX_B Crystallographic Analyses Of Family 11 Endo-Beta-1,4- Xylanase Xyl1 From Streptomyces Sp. S38 [Streptomyces sp. S38]
7EO6_A	7.17e-93	45	230	7	190	Chain A, Endo-1,4-beta-xylanase [Actinomycetia bacterium],7EO6_B Chain B, Endo-1,4-beta-xylanase [Actinomycetia bacterium]
1TE1_B	1.22e-92	45	230	4	189	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
7DFM_A	4.08e-92	40	230	1	190	Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFN_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_E Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_F Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_G Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_H Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_I Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis]
1M4W_A	4.42e-92	45	230	5	188	Thermophilic b-1,4-xylanase from Nonomuraea flexuosa [Thermopolyspora flexuosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CFS3|XYNA_ASPTN	8.26e-139	1	231	1	231	Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xlnA PE=3 SV=1
sp|Q4WG11|XYNA_ASPFU	2.89e-136	1	231	1	228	Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnA PE=1 SV=1
sp|B0XXF3|XYNA_ASPFC	2.89e-136	1	231	1	228	Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xlnA PE=3 SV=1
sp|A1DJ52|XYNA_NEOFI	3.37e-135	1	231	1	228	Probable endo-1,4-beta-xylanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnA PE=3 SV=1
sp|P55332|XYNA_EMENI	6.10e-135	1	231	1	225	Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000303	0.999678	CS pos: 19-20. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_366483-t37_1-p1.