CAZyme Information: P170DRAFT_365925-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_365925-t37_1-p1
• CAZy Family: CE1
• CAZyme Description: putative cutinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222		23033.29	7.1441

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000008:571064-571878(-)

Full Sequence      

MVTLRSILIGALATLAVASPIAEPDHSLEARQLMDSNDLQSGQCKDVTFIFARGSTEMGN
MGTVIGPPTCSGLKAKLGAGKVACQGVGGMYTAGLAQNALPQNTDPGAINEAKKWFNQAA
QKCPDTQIVAGGYSQGSAVIDNAVQGLSSDVKDKVKGVVLFGFTRNLQDHGQIPNYPKDQ
VKVFCAAGDMVCTGTLIITPAHLTYGLNAGEAASFLQSKLSS

Enzyme Prediction     

EC	3.1.1.74:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	43	220	3.4e-46	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.53e-63	43	220	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46952.1|CE5	2.39e-120	1	222	1	223
QRD91206.1|CE5	3.40e-120	1	222	1	223
QMW34880.1|CE5	3.40e-120	1	222	1	223
UDD63915.1|CE5	3.40e-120	1	222	1	223
BAM28634.1|CE5	1.38e-119	1	222	1	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	1.63e-75	28	220	5	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	9.00e-73	33	220	1	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	4.39e-71	19	221	1	199	Chain A, cutinase [Malbranchea cinnamomea]
4OYY_A	4.34e-65	37	220	7	192	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
1CUG_A	6.64e-64	20	220	2	207	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NCM8|CUTI3_ASPFN	6.04e-121	1	222	1	223	Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_039350 PE=3 SV=1
sp|Q2U199|CUTI3_ASPOR	2.46e-120	1	222	1	223	Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000113 PE=3 SV=1
sp|A2R2W3|CUTI1_ASPNC	2.76e-107	1	222	1	226	Probable cutinase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An14g02170 PE=3 SV=1
sp|Q0CNE3|CUTI3_ASPTN	1.42e-106	3	220	2	217	Probable cutinase 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_04791 PE=3 SV=2
sp|Q5AX00|CUTI3_EMENI	1.50e-104	5	221	4	220	Cutinase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000285	0.999699	CS pos: 31-32. Pr: 0.4833

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_365925-t37_1-p1.