CAZyme Information: P170DRAFT_364863-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_364863-t37_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: SUN-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		42365.52	4.5266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000007:2235537-2236893(-)

Full Sequence      

MKYSIALTLATAGSFVAAQHHHQHRHPHKRDADTVIKYVLDGNAISASDVCAGIKKGSLE
YKPGEPTPAVDPCQESTAATSSAASSSTLSVDAAAEFAEVSASVAPATSSAASTPAPSSG
SSSGSSGSSGSSSGTGMDRDFPDGEIDCGSFPSDYGAIALDYLDLGGWSGIQYVTFADEL
ISDIVTAVTGDDCHNGAMCSYACPPGYQKSQWPTTQGSTGQSVGGLQCKGGKLYLTNKKL
SSKLCIEGVGGVHVQNNLGEEVAVCRTDYPGTESETIPLTLGDNDLQPLTCPDANYFKWE
QKVTSAQYYVNPKGTPAKKGCQWGDGSEPIGNWAPINLGVGENNGKWLSISQNAPTTNEK
LDFNIKIKGSDLGGSCKYEDGSFISDTGSNDSGCTVKVNSGDATFVFY

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	105	408	9.2e-104	0.9735973597359736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	2.70e-126	143	395	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD87446.1|GH132	1.15e-186	1	408	1	416
QMW38532.1|GH132	1.15e-186	1	408	1	416
QMW26453.1|GH132	1.15e-186	1	408	1	416
UCK59014.1|GH132	1.15e-186	1	408	1	416
BAE55477.1|GH132	1.83e-185	1	408	1	415

PDB Hits     

P170DRAFT_364863-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	1.70e-171	1	408	1	414	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	1.19e-119	136	407	173	446	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|O43015|YBOH_SCHPO	3.12e-78	138	408	56	319	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|Q9UR09|PSU1_SCHPO	1.00e-77	141	408	162	417	Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psu1 PE=3 SV=1
sp|B3LRC2|UTH1_YEAS1	4.91e-73	140	408	105	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000272	0.999678	CS pos: 18-19. Pr: 0.9703

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_364863-t37_1-p1.