CAZyme Information: P170DRAFT_363711-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_363711-t37_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632	MSFO01000006|CGC2	71257.58	4.6098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:3154073-3156333(+)

Full Sequence      

MHWFATSLFSLGLAVCASAQNSTTVPYELKTPPLDTPWTEKVGTEPWPEYPRPQLQRPKW
QNLNGLWQYRRAENVDAVDSPPFGQALSNEVLIPSCLESALSGIQGKDTFYSWFTRKFTV
PESWSNEHVLLHFGAVDYEATVFVNGKQAGFHRGGYFHFSVDITAQVKFDGENELLVFVH
DPTDQAGHVIPMGKQTLNPSHIFYTPCSGIWQSVWIEPAPANHIVRLDLEANMDGQVNVT
VHSATGNGTAVKIAVHEDDGDLTFHDGTSDKPFQFEVGEVDLWSPDSPTLYNVTVRMGND
EITSYTGFRTISKGKVDGVWRPLLNGEFTFMFGTLDQGYWPDGLYTPPTREAMVYDLKVL
KDLGFNMLRKHIKIESDLFYRACDEIGILVIQDMPSPRPLQSSTDAACQSVTILPYGAAQ
QEFARQLDLMVNQFKSHPSIVTWVIYNEGWGQLIEGYPEFALTERVKQLDPSRLVIATSG
WIDHGAGDFSDNHHYANPQCGTPFYSLQSPPYDPSRIAIQGEFGGIGHNVSIENLWNNQK
AINAINETYEIDETIDAWNYRSHILLSELQDQVRRFDCSGGVWTQTTDVEGEVNGLMTYD
RRLKRVDEEQWKDDIQGLYDAAENRRNASMTA

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	55	499	1.8e-103	0.5093085106382979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	7.05e-38	61	475	13	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	7.19e-36	62	475	14	445	beta-D-glucuronidase; Provisional
236673	ebgA	3.22e-23	59	489	40	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	8.92e-12	112	220	67	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
395572	Glyco_hydro_2	1.81e-09	225	309	8	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR88823.1|GH2	0.0	26	629	34	638
BAE58640.1|GH2	0.0	26	625	48	645
UDD59220.1|GH2	0.0	26	625	34	631
QMW41001.1|GH2	0.0	26	625	34	631
QMW28926.1|GH2	0.0	26	625	34	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.49e-115	34	613	12	577	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3GM8_A	5.09e-28	112	491	68	435	Chain A, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6D8G_A	3.99e-26	61	448	36	426	D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
5UJ6_A	6.95e-26	61	448	28	418	Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	7.01e-26	61	448	36	426	Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KM09|PLH16_FORAG	7.99e-22	113	510	109	494	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KPJ7|PLH8_FORAG	2.71e-21	47	528	40	521	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	1.52e-18	110	443	56	382	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|Q56307|BGAL_THEMA	6.05e-18	25	475	1	464	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
sp|P24131|BGAL_CLOAT	7.14e-18	58	603	44	601	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000361	0.999622	CS pos: 19-20. Pr: 0.9615

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_363711-t37_1-p1.