CAZyme Information: P170DRAFT_362838-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_362838-t37_1-p1
• CAZy Family: CBM48
• CAZyme Description: putative BNR/Asp-box repeat protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MSFO01000006|CGC9	41396.37	6.9651

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:2436000-2437115(-)

Full Sequence      

MPGHLGQKILKTFGLDEHQHHHHQQQQQHPPHQEYRLSGNRVINNDERILSPHPRGTYPR
LARLSDGTILGSFTRFEGKTRVLCVSKSVDGGRSFEDIGEVTRGDGDVDNMFLLEVAPSV
VLAAFRNHDRGPNGPTHFRITVCRSTDGGRHWGFASQAAEKRAPLGIWEPFMRLGRQGEV
QLTYSQEFAHNNQCTMLVRSFDQGSTWSPPQCLEGEKDLFRDGMNGIAPTYDNGREALVM
VFETTTFGTFDLEALISYDDGYTWGHRHRVYVPPRGHNAGSPQIASFADGSMAVIFMTDE
DSDQVQWTKNAAIKVVFAGPPQNGQITWTRPTVICPHASHWPGILALDHHTLLATYECGG
APRAKSITLHL

Enzyme Prediction     

No EC number prediction in P170DRAFT_362838-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	54	315	3.7e-70	0.9120521172638436

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	1.29e-09	113	369	19	335	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.19e-07	71	303	101	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	4.36e-05	47	152	190	293	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	9.13e-05	63	236	152	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	1.72e-04	64	219	119	263	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24955.1|GH93	2.67e-210	4	370	3	365
EAA62412.1|GH93	1.01e-203	1	369	1	366
QMW42642.1|GH93	3.67e-202	1	370	1	379
QMW30589.1|GH93	3.67e-202	1	370	1	379
QRD89469.1|GH93	3.67e-202	1	370	1	379

PDB Hits     

P170DRAFT_362838-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P170DRAFT_362838-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999191	0.000837

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_362838-t37_1-p1.