CAZyme Information: P170DRAFT_362029-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_362029-t37_1-p1
• CAZy Family: AA9
• CAZyme Description: aryl-alcohol dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608	MSFO01000006|CGC26	66493.92	4.8661

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:594702-596612(+)

Full Sequence      

MADLKSSYDYIVIGAGIGGLTVASRLSEDVDVNVLLVEAGANRMGDPRVETPGFIGLQYG
NPEFDWDYMSEPQVHANNRQIGQPRGRMVGGSSGMNFSLIMYPSSANFEAWESLGNDGWG
AETMAPYLRKFHTYTSPSETTSKLLATDRYMKEHDQGADGPVPVTLPDIYGPFNEAWDKT
FEQLGFSSDADPIAGRKLGAFTSPLSVDPKTGQRGYAAAYYSPEVAQRPNFDLISEAMVE
RILLNNEADGEVVATGIQIRTKDGKQQQISGGREVILSAGTLNSPQLLELSGIGSKEVLQ
KHDIPVVLDRPGVGENLQDHALTSLNFEIADGQISGDILRDPNVLQSVIKLYEETRGGPL
AGMPISVAYLPLVDHEGKLSQEIVEDLLAKHLDNESLSPARQRQYDVQRKVLLDSQNASS
EYIFLPAQLHMNPGATTMNDVLAKTLPGNYISIMIMHNHPFSRGSVHIRSSKIDDKPIYD
PNYLSHPLDLEILARHTQFADQIATTEPFASLLKPGAREPQSAADLSNLDKTKDLVKERL
YHCFHPVGTCAMMPADLGGVVDPQLKVHGTRNLRVVDASVFPLEPTGNIQALTYAVAERA
ADIIRSSR

Enzyme Prediction     

No EC number prediction in P170DRAFT_362029-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	605	1.5e-178	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.05e-98	1	606	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.45e-93	7	605	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.41e-42	460	600	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.60e-31	6	591	54	563	Protein HOTHEAD
366272	GMC_oxred_N	4.63e-27	76	320	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96633.1|AA3_2	0.0	1	605	1	606
CAK96255.1|AA3_2	0.0	1	605	1	606
UDD56791.1|AA3_2	6.37e-310	1	607	1	609
QMW28733.1|AA3_2	5.21e-309	1	607	1	609
QRD83267.1|AA3_2	5.21e-309	1	607	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.80e-84	6	605	4	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.49e-73	3	605	1	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.65e-69	8	608	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.73e-68	6	608	1	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5ZU3_A	6.12e-63	6	606	5	571	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	7.63e-110	4	604	10	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	2.19e-109	4	605	10	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.19e-109	4	605	10	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.28e-83	5	605	37	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	8.88e-74	7	604	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993891	0.006116

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_362029-t37_1-p1.