CAZyme Information: P170DRAFT_361944-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_361944-t37_1-p1
• CAZy Family: AA9
• CAZyme Description: FAD/NAD(P)-binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564	MSFO01000006|CGC25	60222.69	6.8792

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:648328-650074(-)

Full Sequence      

MRYLQTGYQAALVAAISGLTAASSFQNGSYDYIVVGGGPAGIITAERFTEAGKKVLLLER
GVGPTVATGANETLPWNHDLTAVDLPGMSADIGNTDAWTNYICTDTEGTAACVLGGGVTL
NYMVFVHPPDHDFDDNNNWPSGWKSNDLKPASERLYQRNPGTILPSADGKRYDQGLYNVL
SNFFSNLGWKAVNMITQPNEKHQAYSYPSWNIKDQKRAGPVRTYLPLAQKSENFSLRLGT
KVLRVVRDGSRVTGVEVQTSSGKTEIVTLAANGRVVLAAGALSTPRVLFNSGIGPKKQIE
TAQKSGISVPSENQWLELPVGVGLRDHPIFSIVVQTNGSFGVPDYDRILNGTDRKDIALY
RQGSGLLTQGKHRMIFFTSNEVNGKTVYYQGSCAPDANSVLGITAYMTHGATSTGVLGID
STQKTVIEQSPYLQTDADKQAASVFVKQMIRDITAPGTGLKLTTNLNESAIIDSMTPGIH
YTSTAKMGTDSGLNGGSSVVDTNTKVYGMDNLYVVDGSIHPDLPTGNIQSTIMIVAEAAA
ARILGQDAHASHQGKGNATACPFA

Enzyme Prediction     

No EC number prediction in P170DRAFT_361944-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	21	545	1.2e-193	0.9817518248175182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.29e-47	23	545	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	6.56e-39	31	541	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	1.48e-31	29	547	5	535	choline dehydrogenase; Validated
366272	GMC_oxred_N	7.69e-21	113	329	26	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.28e-20	432	539	24	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29639.1|AA3_1	1.49e-292	1	546	1	546
QQK48042.1|AA3_1	4.75e-280	1	544	1	542
QMW45398.1|AA3_1	5.02e-280	1	546	1	539
QRD84961.1|AA3_1	5.02e-280	1	546	1	539
QMW33361.1|AA3_1	5.02e-280	1	546	1	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	1.08e-98	29	549	229	769	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
1NAA_A	6.74e-96	30	544	3	535	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	7.73e-96	30	544	8	540	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI4_A	2.77e-92	29	544	7	543	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	4.26e-90	29	544	229	765	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	6.93e-93	17	544	222	767	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	5.65e-26	30	544	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	1.02e-25	30	544	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	2.54e-25	26	545	1	532	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	1.75e-24	25	540	36	604	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.643741	0.356248

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_361944-t37_1-p1.