CAZyme Information: P170DRAFT_359986-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_359986-t37_1-p1
• CAZy Family: AA9
• CAZyme Description: UDP-glucoronosyl and UDP-glucosyl transferase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		55103.98	8.4787

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000005:1426528-1428153(+)

Full Sequence      

MENSSILFFTNCELGQASIILAVAHEFLLRPSYSVHIASFPSLAPDVDILNERAKMLASA
TTTATFHPINGPSMVDVYSHTPVFLDHFDYHQIGFRGASQAFNQFIPMLMNPWDGSQFVA
IYRDCVDIIKKVRPAMVVLDPLFVIGLDACRVLRWPHVVLSPNTAKDLAPQPWLANLWKY
PVLCSGYPYPVPWYLIPLNIFLTIKIALIIMGNQRVRKLRDYRNKHGIPGPNPLFASPPG
DKTPYLLVTTPAADFPCFVPQNFTLCGPIVRPCAPIAQESPQLAAWLSLRPTVLVNMGSH
VTCSPEQERQFAEGFRMLLDKRRDVQILWKLKRRGERQESALDCLREAIEGNRVRIESWL
SVEPICVLLSGQVKCMIHHGGSNSYHEAVRAGVPQIVLPTWFDTYDFAHRAEFRGIGVWG
NRNTAPAVKGVDLGKALIRVLASEESIGMADRAKKVVTQLEGEGRTIACEKIVDLIRSQK
DENKSSVSLTRQ

Enzyme Prediction     

No EC number prediction in P170DRAFT_359986-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	81	459	5.1e-17	0.8717277486910995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	8.07e-32	6	475	3	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	4.74e-12	6	486	4	405	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	6.99e-07	293	418	272	389	UDP-glucosyl transferase
178170	PLN02555	2.77e-05	286	403	270	386	limonoid glucosyltransferase
177813	PLN02152	4.76e-05	279	464	247	440	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW30045.1|GT1	5.31e-179	1	476	1	481
UDD61742.1|GT1	5.31e-179	1	476	1	481
QMW42118.1|GT1	2.86e-174	1	468	1	473
BCS26405.1|GT1	3.24e-166	1	477	1	484
BCR88350.1|GT1	1.71e-158	5	477	3	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IIR_A	8.23e-08	368	480	297	402	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	1.82e-06	372	480	302	403	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	5.44e-96	6	476	8	488	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	8.50e-83	2	441	4	466	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	3.99e-10	373	474	461	560	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	4.92e-09	373	454	460	539	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|Q63ZR6|UD3A1_XENLA	1.78e-08	245	444	247	431	UDP-glucuronosyltransferase 3A1 OS=Xenopus laevis OX=8355 GN=ugt3a1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_359986-t37_1-p1.