CAZyme Information: P170DRAFT_358842-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_358842-t37_1-p1
• CAZy Family: AA8|AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	MSFO01000004|CGC16	24771.77	5.2992

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000004:84684-85531(+)

Full Sequence      

MLSKLPLLAAFMPTALACLGYEGGVPKATATHSNSAVIEVAAGQVFDGGWARYDRGSGAC
GGQNEGDWKDAVFYLQSGATLKNVIIGKNQAEGVHCNGPCTLEFVWFEDVCEDAISVKND
KSGQETWIIGGGAYHASDKVVQHNGCGTVNIINFYVEDYGKLYRSCGNCSKQCKRNVYVE
GVTARDGGELVGINSNYGDTATLKNVCYDTKNPCVTYEGCAGGCEPKKVGTCSG

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	29	219	3.2e-91	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.14e-119	22	224	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46280.1|PL3_2	4.20e-147	1	234	1	234
QMW34226.1|PL3_2	4.20e-147	1	234	1	234
UDD63130.1|PL3_2	4.20e-147	1	234	1	234
QRD94021.1|PL3_2	1.42e-146	1	234	35	268
EGX48986.1|PL3_2	1.43e-141	4	234	7	237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	1.10e-29	38	203	9	180	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	9.85e-21	38	183	14	152	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.01e-20	38	183	15	153	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
3B90_A	3.64e-20	51	206	7	178	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4Z03_A	8.88e-20	38	183	23	161	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y953|PLYF_ASPFC	2.72e-150	1	234	1	234	Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyF PE=3 SV=1
sp|Q0CCF8|PLYF_ASPTN	7.79e-150	1	234	1	234	Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyF PE=3 SV=1
sp|A1D5E3|PLYF_NEOFI	4.50e-149	1	234	1	234	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1
sp|Q4WKV8|PLYF_ASPFU	9.09e-149	1	234	1	234	Probable pectate lyase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyF PE=3 SV=1
sp|B8NJZ7|PLYF_ASPFN	7.46e-148	1	234	1	234	Probable pectate lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000556	0.999413	CS pos: 17-18. Pr: 0.9656

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_358842-t37_1-p1.