CAZyme Information: P170DRAFT_354694-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_354694-t37_1-p1
• CAZy Family: AA7
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601		65281.37	6.6614

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:47207-49182(-)

Full Sequence      

MLCKAILALALCPLIGAQGLLGNNEYDYIVVGGGTGGNVIATRLAEKDFKVALVEAGGHY
ELQSFAAVPAADALPVGSSPRVKSSIDWGFITEPFPGANNRAIHFARGKTLGGSSALNFM
IYQRPTVDSMQQWADTVDDKSYTFDQVLPFYKRSTHFTPPNADIRFPNASAKYAESAFEQ
KAGPLEVSYANYAMPFSTWMKLGMEAIGISEAEDFNSGSLMGNQYCSSTIRPGDQTRSSS
ESSFLKSPPGSLDIHENTLAKKIIFNKNKKATGVQIKGPLGGVSTLKASKEVIVSAGAFQ
SPQLLMVSGVGPADTLKEHDIEVISNLPGVGQNMWDHPFFGPSYRVNVTTFTKIARNLLY
LLGQFLNSVVAKKGPLTNPIADFLAWEKIPAKLRESFSAQVQKTLQQFPKDWPEAEYISG
AGYIGNFSDLLTTQPQDGFQYASMLGVLVAPTSRGNVTLKSADTSDLPLINPNWLATESD
QQLAIAMFKRMREAFHSKAMAPVVIGEEYYPGNKVSSDEQILDFIRNHVMTLWHPACTCK
MGTKDDEMAVLDSQARVYGVSGLRVVDASSFPILPPGHPQSTVYMLAEKIADLMTSTNKS
S

Enzyme Prediction     

No EC number prediction in P170DRAFT_354694-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	25	595	1.2e-179	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.93e-100	23	594	3	531	choline dehydrogenase; Validated
225186	BetA	7.92e-90	40	594	22	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.22e-47	451	590	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.05e-25	271	586	257	568	Protein HOTHEAD
366272	GMC_oxred_N	1.87e-18	98	338	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10571.1|AA3_2	1.11e-308	18	592	60	634
UCK58435.1|AA3_2	5.26e-306	15	594	33	612
BCR98123.1|AA3_2	2.91e-304	18	592	32	625
QRD88023.1|AA3_2	2.31e-299	15	583	33	601
QMW25940.1|AA3_2|GT4	3.15e-299	15	594	504	1083

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	4.05e-59	25	594	1	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.12e-58	25	594	2	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	3.01e-53	23	599	3	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
2JBV_A	3.37e-53	21	596	9	528	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	3.37e-53	21	596	9	528	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A075TRK9|PATE_PENEN	5.57e-177	19	591	45	621	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	6.33e-176	19	591	44	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	5.85e-175	18	598	33	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A1U8QYA8|CICC_EMENI	7.74e-159	13	592	22	605	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	2.30e-133	19	592	38	591	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000659	0.999327	CS pos: 17-18. Pr: 0.9778

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_354694-t37_1-p1.