CAZyme Information: P170DRAFT_352612-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_352612-t37_1-p1
• CAZy Family: AA7
• CAZyme Description: putative pectinesterase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MSFO01000002|CGC9	35990.68	4.7240

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:801546-802886(+)

Full Sequence      

MFKSVLTSAFFAATALAASRMTAPAGAIVVAKSGGDYTTISDAVGNLSTTATTTQSIFIE
KGTYDEQVYIPSMKGELLIYGQTEDTTTYEKNLVKVTHNIKLADVENDDHTATVRNHAEN
SSVYNLNFENSCGQVCHQALAVSAYGENQGYYGCKFIGYQDTLLAQSGNQIYAKSLIQGA
VDFIFGQSARAWFHQCDIRVVEGPSAAHITANGRRSESDESYYVIHKSTVEAADGDSVKA
GTYYLGRPWSEYARVVFQKTSMSDVINSAGWAEWSDASPNTDNVTYAEYGNTGKGAKGDR
VSFSHKLDEAISISEILGADWQSWVDTSYVL

Enzyme Prediction     

EC	3.1.1.11:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	309	1.1e-83	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	5.64e-56	28	304	2	275	Pectinesterase.
178051	PLN02432	2.25e-44	23	321	8	291	putative pectinesterase
215367	PLN02682	3.77e-44	24	321	67	366	pectinesterase family protein
177947	PLN02313	5.46e-43	22	296	272	541	Pectinesterase/pectinesterase inhibitor
178346	PLN02745	5.96e-43	23	297	282	552	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW31157.1|CE8	2.60e-180	1	330	1	330
QRD90091.1|CE8	2.60e-180	1	330	1	330
UDD60027.1|CE8	2.60e-180	1	330	1	330
BAE60873.1|CE8|3.1.1.11	5.24e-180	1	330	1	330
QMW43208.1|CE8	2.13e-179	1	330	1	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.87e-69	19	329	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	3.74e-69	19	329	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.31e-37	28	296	10	273	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	4.06e-31	25	296	3	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	4.88e-13	34	296	45	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	2.42e-176	1	330	1	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	9.28e-160	1	329	1	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A2QK82|PMEA_ASPNC	2.21e-68	19	329	30	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	3.20e-67	20	329	28	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	6.38e-67	20	329	28	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000483	0.999478	CS pos: 17-18. Pr: 0.9733

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_352612-t37_1-p1.