CAZyme Information: P170DRAFT_351819-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_351819-t37_1-p1
• CAZy Family: AA7
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632	MSFO01000002|CGC20	68056.15	4.5386

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:3683996-3685894(+)

Full Sequence      

MRFLPIPGLVGFAAAQSISHLDLFDYGQRGPLLGSSFGTPGANATYDYVIVGGGTAGLTI
ASRLALSQSNLSVAVVEAGGFYEVDNGNFSVVPGYGTLFSGLDPRDTNPLVDWGINTVPQ
QGAGNRVLHYARGKTLGGSSARNYMFYQRPTAGSMQKWADEVDDQSFVWDKILPYFKKST
HYTPPNPALYSNASDTPIIQAPDAFDPAGGPLQVSFSNFVSSFSGWLRLAFDLAGMPQID
GFNSGKLLGSGFGTSTINPKNAHRSSSESSFLQTALNSGSEPVVYKNTLGQKILFDSDKV
ATGVQVSTAGTFGTQPISFTLSAREEIILSTGAFQSPQLLMVSGVGPCDEISEFEIPCIS
DLPGVGKNLQDHVMFGPSHRVHLETTSVFSNNATATALSVQQYLQDASGRLSIAVPSYYG
WEKLPEPYRSQLSAESIEALADYPEDWPEVEWLPLDAFVGDSSFRQGLDPADGHNYATIA
AGLVAPQSRGSVKLNSTDMNTLPVVDPAFLVDPTDIELAILSFKRSREIWGKLVDLGIAE
PEYYPGKNVTTDEQIHDFIEQTLSTIYHASSTCKMGKESDPMAVVDSKARVYGVHRLRVV
DTSAFPFLVPGHPQSTAYALAEKIADEILNEE

Enzyme Prediction     

No EC number prediction in P170DRAFT_351819-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	45	630	4.7e-173	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.08e-89	42	631	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.92e-83	42	629	2	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.55e-41	486	624	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.16e-35	17	631	27	579	Protein HOTHEAD
366272	GMC_oxred_N	2.42e-20	123	372	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW37598.1|AA3_2	2.39e-315	1	630	1	626
QMW25513.1|AA3_2	2.39e-315	1	630	1	626
QRD88504.1|AA3_2	2.39e-315	1	630	1	626
UCK57946.1|AA3_2	2.39e-315	1	630	1	626
QGA19805.1|AA3_2	1.23e-275	6	628	14	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.72e-51	43	631	3	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6YS1_AAA	2.31e-50	39	625	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	2.97e-50	35	625	13	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YRU_AAA	3.17e-50	39	625	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
7AV4_AAA	3.73e-50	35	625	73	633	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	2.75e-196	5	628	3	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	6.33e-187	25	628	34	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.15e-166	33	629	23	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	2.69e-158	3	630	7	595	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.10e-155	43	628	38	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.669849	0.330167

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_351819-t37_1-p1.