CAZyme Information: P170DRAFT_351543-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_351543-t37_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		41906.02	7.3007

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:3439922-3441227(+)

Full Sequence      

MRRWNSITVKIVVAALCSYAVFSILLGDRETYNSTRNLVRAGQRRIYGSTFDRINNETLG
FEKVFAIGLKERSDKRDFLTLAASVSDIKVEWIDGRYNTSWLKPTVAGCWRAHMNAMQEI
VNNRYSTALILEDDADWDVSIRQQLREFAQGVRTITNNQKAPKQTPYGTNWDVLWVGGCS
AGPGSQESNIYAVPNDPTVAAVRHRRNIWGGPSETWKKKHPEYPEDSTRYIFRAQTGCCT
YGYAVTYEGARRMIAALSVDYMDLAIDNSMSDMCAGNNREQIRCYGPYPNIIGTYKQAGF
ASRGSDIEVYNDEYHEASAHNMIYSTRMNIHRLLAGDDTVSGQYADEQDTWLKGEVKISE
LQYPAGRLVP

Enzyme Prediction     

No EC number prediction in P170DRAFT_351543-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	62	270	3.4e-27	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	6.24e-16	63	138	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE63398.1|GT25	2.73e-163	1	369	5	394
QRD94314.1|GT25	2.73e-163	1	369	5	394
UDD62811.1|GT25	2.73e-163	1	369	5	394
BCS10899.1|GT25	1.72e-142	1	369	1	375
BCS22810.1|GT25	6.58e-142	9	369	28	404

PDB Hits     

P170DRAFT_351543-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5PK45|GT251_BOVIN	1.44e-09	57	314	337	582	Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1
sp|Q8K297|GT251_MOUSE	1.05e-08	53	313	327	575	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2
sp|Q8NBJ5|GT251_HUMAN	1.41e-08	57	314	336	581	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
sp|Q6NVG7|GT252_MOUSE	7.42e-07	57	256	336	512	Procollagen galactosyltransferase 2 OS=Mus musculus OX=10090 GN=Colgalt2 PE=2 SV=2
sp|Q8IYK4|GT252_HUMAN	2.30e-06	57	256	337	513	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.990047	0.009981

TMHMM  Annotations     

Start	End
7	26